| Clone Name | rbaet16a03 |
|---|---|
| Clone Library Name | barley_pub |
>RM32_CAEEL (Q04907) Putative 39S ribosomal protein L32, mitochondrial| precursor Length = 168 Score = 28.5 bits (62), Expect = 6.6 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = -1 Query: 235 RDIDPVGHHQN*PACASVRASEPDCD*CTYLDSLLCALVPVNKQLVNANPYV 80 R + P+ + PAC+++ S+ CD C L + + K+++ NPYV Sbjct: 73 RLLQPIDNLVTCPACSNIHPSDTICDACYAKVHQLTS--EIKKKMMQYNPYV 122
>P53_CHICK (P10360) Cellular tumor antigen p53 (Tumor suppressor p53)| Length = 367 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 297 GSRCL*ARVCVCAGDDSVLEKE 232 G RC RVC C G D +E+E Sbjct: 252 GRRCFEVRVCACPGRDRKIEEE 273
>RNPC2_MOUSE (Q8VH51) RNA-binding region-containing protein 2 (Coactivator of| activating protein 1 and estrogen receptors) (Coactivator of AP-1 and ERs) (Transcription coactivator CAPER) Length = 530 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 127 HKARNLSRYINHNQARSHEQKRKRASSDDDPRDR 228 H+ R+ R + +++RSHE+KR ++ RDR Sbjct: 28 HEERSKKRKKSKSRSRSHERKRSKSKERKRSRDR 61
>RNPC2_HUMAN (Q14498) RNA-binding region-containing protein 2 (Hepatocellular| carcinoma protein 1) (Splicing factor HCC1) Length = 530 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 127 HKARNLSRYINHNQARSHEQKRKRASSDDDPRDR 228 H+ R+ R + +++RSHE+KR ++ RDR Sbjct: 28 HEERSKKRKKSKSRSRSHERKRSKSKERKRSRDR 61
>CPSF6_BRARE (Q6NWC6) Cleavage and polyadenylation specificity factor 6| Length = 545 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 127 HKARNLSRYINHNQARSHEQKRKRASSDDDPRDR 228 HK+R+ R+ ++ + RS E+ R R D RDR Sbjct: 503 HKSRSRDRHEDYYRERSRERDRHRERDRDRERDR 536 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,501,098 Number of Sequences: 219361 Number of extensions: 831387 Number of successful extensions: 1897 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1895 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)