| Clone Name | rbaet15a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OST2_HUMAN (Q9Y278) Heparan sulfate glucosamine 3-O-sulfotransfe... | 28 | 4.8 | 2 | YPB3_ECOLI (P03851) Hypothetical 9.4 kDa protein | 28 | 8.1 | 3 | RFC2_MOUSE (Q9WUK4) Activator 1 40 kDa subunit (Replication fact... | 28 | 8.1 |
|---|
>OST2_HUMAN (Q9Y278) Heparan sulfate glucosamine 3-O-sulfotransferase 2 (EC| 2.8.2.29) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2) (Heparan sulfate 3-O-sulfotransferase 2) (h3-OST-2) Length = 367 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = +1 Query: 73 TNHHGSAHIGLDKFPKVVVIYSEDGRPGSSSPMMKLHPASKGQN*Q----DCR*LRGLDW 240 +NH GS +G + P+ +++ + G + +++HP + + D RGLDW Sbjct: 101 SNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGRGLDW 160
>YPB3_ECOLI (P03851) Hypothetical 9.4 kDa protein| Length = 84 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 65 TPSRITMARPISALTNFLRWW 127 T +RI+ AR + T FL+WW Sbjct: 35 TGNRISRARYVGGATEFLKWW 55
>RFC2_MOUSE (Q9WUK4) Activator 1 40 kDa subunit (Replication factor C 40 kDa| subunit) (A1 40 kDa subunit) (RF-C 40 kDa subunit) (RFC40) Length = 349 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 48 LPSITTRHHESPWLGPYRP 104 +PS T H+E PW+ YRP Sbjct: 21 VPSKTAGHYELPWVEKYRP 39 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,605,713 Number of Sequences: 219361 Number of extensions: 903930 Number of successful extensions: 1817 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1817 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)