| Clone Name | rbaet14e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NRBP_PONPY (Q5RBH9) Nuclear receptor-binding protein | 29 | 2.6 | 2 | NRBP_MACFA (Q4R8X0) Nuclear receptor-binding protein | 29 | 2.6 | 3 | NRBP_HUMAN (Q9UHY1) Nuclear receptor-binding protein | 29 | 2.6 | 4 | CATA_BACST (P14412) Peroxidase/catalase (EC 1.11.1.6) (Catalase-... | 29 | 3.4 | 5 | NRBP_MOUSE (Q99J45) Nuclear receptor-binding protein (MLF1 adapt... | 29 | 3.4 |
|---|
>NRBP_PONPY (Q5RBH9) Nuclear receptor-binding protein| Length = 535 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 132 IRQH*RRQGVITEE*KRRSMVAFLSLTHMHAQTLNEAGWARW 257 I+++ R ITE S+ FL T + +T+NE W RW Sbjct: 139 IKENKARVIFITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRW 180
>NRBP_MACFA (Q4R8X0) Nuclear receptor-binding protein| Length = 535 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 132 IRQH*RRQGVITEE*KRRSMVAFLSLTHMHAQTLNEAGWARW 257 I+++ R ITE S+ FL T + +T+NE W RW Sbjct: 139 IKENKARVIFITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRW 180
>NRBP_HUMAN (Q9UHY1) Nuclear receptor-binding protein| Length = 535 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 132 IRQH*RRQGVITEE*KRRSMVAFLSLTHMHAQTLNEAGWARW 257 I+++ R ITE S+ FL T + +T+NE W RW Sbjct: 139 IKENKARVIFITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRW 180
>CATA_BACST (P14412) Peroxidase/catalase (EC 1.11.1.6) (Catalase-peroxidase)| Length = 735 Score = 28.9 bits (63), Expect = 3.4 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 190 WWPFSLSLTCMHRH*TRPDGHD 255 WWP L+L+ +H+H + + HD Sbjct: 31 WWPNQLNLSILHQHDRKTNPHD 52
>NRBP_MOUSE (Q99J45) Nuclear receptor-binding protein (MLF1 adapter molecule)| (HLS7-interacting protein kinase) Length = 535 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 132 IRQH*RRQGVITEE*KRRSMVAFLSLTHMHAQTLNEAGWARW 257 ++++ R ITE S+ FL T + +T+NE W RW Sbjct: 139 VKENKARVIFITEYMSSGSLKQFLKKTKKNHKTMNEKAWKRW 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,658,452 Number of Sequences: 219361 Number of extensions: 708782 Number of successful extensions: 1619 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1619 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)