| Clone Name | rbaet14c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZBP1_RAT (Q8VDA5) Z-DNA-binding protein 1 (Tumor stroma and acti... | 29 | 2.9 | 2 | BPA1_HUMAN (Q03001) Bullous pemphigoid antigen 1 isoforms 1/2/3/... | 29 | 3.9 |
|---|
>ZBP1_RAT (Q8VDA5) Z-DNA-binding protein 1 (Tumor stroma and activated| macrophage protein DLM-1) Length = 409 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +3 Query: 78 TQMLATYS*KQQPNHARCQRILYEDPGNVNGDHPINQSCQLG 203 TQM Y Q+ C + E P + +PIN CQ G Sbjct: 140 TQMWTIYRSSQEGQERACSGVGQESPAVIYQQNPINMICQQG 181
>BPA1_HUMAN (Q03001) Bullous pemphigoid antigen 1 isoforms 1/2/3/4/5/8 (230 kDa| bullous pemphigoid antigen) (BPA) (Hemidesmosomal plaque protein) (Dystonia musculorum protein) (Dystonin) (Fragment) Length = 3214 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 89 CYVQLKTTAQSCTLPKDFVRGPRKCQ 166 C +Q K+TA+ CT DF ++CQ Sbjct: 2430 CEIQKKSTAKDCTFKPDFEMTVKECQ 2455 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,966,602 Number of Sequences: 219361 Number of extensions: 500269 Number of successful extensions: 934 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)