| Clone Name | rbaet14b08 |
|---|---|
| Clone Library Name | barley_pub |
>CP19A_LAGAC (Q69FB6) Cytochrome P450 19A1 (EC 1.14.14.1) (Aromatase) (CYPXIX)| (Estrogen synthetase) (P-450AROM) Length = 503 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +1 Query: 247 LILIWCFPSTQSPPWPALFPPLG--VVKCRALPFTAGKSTCSY 369 L+L+W + T S P P F +G + CR L G STC+Y Sbjct: 35 LLLVWNYEDTSSIPGPGYFLGIGPLISHCRFLWMGIG-STCNY 76
>STFE_ECOLI (P33227) Side tail fiber protein homolog from lambdoid prophage e14| (Fragment) Length = 166 Score = 28.9 bits (63), Expect = 3.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 286 PWPALFPPLGVVKCRALPFTA 348 PWP+ PP G +KC F+A Sbjct: 16 PWPSATPPTGWLKCNGAAFSA 36
>CP19A_SHEEP (Q9XS28) Cytochrome P450 19A1 (EC 1.14.14.1) (Aromatase) (CYPXIX)| (Estrogen synthetase) (P-450AROM) Length = 503 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +1 Query: 247 LILIWCFPSTQSPPWPALFPPLG--VVKCRALPFTAGKSTCSY 369 L+L+W + T S P P+ F +G + CR L G S C+Y Sbjct: 35 LLLVWNYEDTSSIPGPSYFLGIGPLISHCRFLWMGIG-SACNY 76
>CP19A_CAPHI (Q6YI21) Cytochrome P450 19A1 (EC 1.14.14.1) (Aromatase) (CYPXIX)| (Estrogen synthetase) (P-450AROM) Length = 503 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +1 Query: 247 LILIWCFPSTQSPPWPALFPPLG--VVKCRALPFTAGKSTCSY 369 L+L+W + T S P P+ F +G + CR L G S C+Y Sbjct: 35 LLLVWNYEDTSSIPGPSYFLGIGPLISHCRFLWMGIG-SACNY 76
>CP19A_BOVIN (P46194) Cytochrome P450 19A1 (EC 1.14.14.1) (Aromatase) (CYPXIX)| (Estrogen synthetase) (P-450AROM) Length = 503 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +1 Query: 247 LILIWCFPSTQSPPWPALFPPLG--VVKCRALPFTAGKSTCSY 369 L+L+W + T S P P+ F +G + CR L G S C+Y Sbjct: 35 LLLVWNYEDTSSIPGPSYFLGIGPLISHCRFLWMGIG-SACNY 76 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,812,124 Number of Sequences: 219361 Number of extensions: 884078 Number of successful extensions: 1929 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1929 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)