| Clone Name | rbaet13g09 |
|---|---|
| Clone Library Name | barley_pub |
>CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Protein Xantha-l) Length = 417 Score = 101 bits (252), Expect = 4e-22 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -3 Query: 385 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY Sbjct: 367 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 417
>CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 88.6 bits (218), Expect = 3e-18 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -3 Query: 385 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 +GE++D+PLVKNLKR+PLIA L SE++A YLMPPIESGSVDFAEFEP+LVY Sbjct: 355 VGETSDIPLVKNLKRIPLIAALASELLATYLMPPIESGSVDFAEFEPQLVY 405
>CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 87.8 bits (216), Expect = 6e-18 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 385 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 +GE+ D +VKNLKRVPLIA LVSEI+AAYLMPPIESGSVDFAEFEPKLVY Sbjct: 355 VGETEDNSVVKNLKRVPLIAALVSEILAAYLMPPIESGSVDFAEFEPKLVY 405
>CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Copper response defect 1 protein) (Dicarboxylate diiron protein) (AtZIP Length = 409 Score = 80.5 bits (197), Expect = 9e-16 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = -3 Query: 385 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 IGE++D +K LKR+PL+ L SEI+AAYLMPP+ESGSVDFAEFEP LVY Sbjct: 359 IGETDDASFIKTLKRIPLVTSLASEILAAYLMPPVESGSVDFAEFEPNLVY 409
>CTH1_CHLRE (Q9AR22) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) (Copper target homolog 1 protein) Length = 407 Score = 36.6 bits (83), Expect = 0.015 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = -3 Query: 385 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 IG N +K + + P++ ++V+E+ ++M P ESGS D + LVY Sbjct: 357 IGSMNLPSPIKAIMKAPILERMVAEVFQVFIMTPKESGSYDLDANKTALVY 407
>ACSF_PORPU (P51277) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 349 Score = 32.3 bits (72), Expect = 0.28 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -3 Query: 385 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV 266 I + PLVK + PL L+ +I YL+ PI+S +V Sbjct: 305 IDKKGSQPLVKTFMKAPLYMSLILNLIKIYLIKPIDSQAV 344
>ACSF1_ANASP (Q8YX57) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) Length = 351 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = -3 Query: 385 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIES 275 I S+ VK ++++PLIA +V ++ YL+ PI++ Sbjct: 307 IERSSQPKFVKLIRKLPLIAAIVWNLLMVYLIKPIDT 343
>LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1268 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -2 Query: 227 LSKKDSSLPIFTNIMMHHAPRESLNEHRVHG*LT*STSSCAHL 99 +S + + P N+ +HH P S+ HR+ G +S HL Sbjct: 214 ISAEVQAPPPVVNVRVHHPPEASVQVHRIEGPNAEGPASSQHL 256
>GRIPE_HUMAN (Q6GYQ0) GTPase-activating Rap/Ran-GAP domain-like 1| (GAP-related-interacting partner to E12) (GRIPE) (Tuberin-like protein 1) Length = 2036 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 190 FVKIGRDESFFDKFSRQAWAQIRQNQRSQTRLGA*GTQR 306 F K+ D+SF +SR Q QRS T G+ GT++ Sbjct: 707 FQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEK 745
>GRIPE_MOUSE (Q6GYP7) GTPase-activating RapGAP domain-like 1| (GAP-related-interacting partner to E12) (GRIPE) (Tuberin-like protein 1) Length = 2035 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 190 FVKIGRDESFFDKFSRQAWAQIRQNQRSQTRLGA*GTQR 306 F K+ D+SF +SR Q QRS T G+ GT++ Sbjct: 706 FQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEK 744 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,842,855 Number of Sequences: 219361 Number of extensions: 966862 Number of successful extensions: 1892 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1892 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)