| Clone Name | rbaet13e07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTR_NEUCR (P38680) N amino acid transport system protein (Methyl... | 36 | 0.056 | 2 | UNC47_CAEEL (P34579) Vesicular GABA transporter (Uncoordinated p... | 30 | 2.3 | 3 | S36A1_MOUSE (Q8K4D3) Proton-coupled amino acid transporter 1 (Pr... | 29 | 6.8 | 4 | LIAF_BACSU (O32199) Protein liaF | 28 | 8.9 | 5 | MRAY_CHRVO (Q7NPZ6) Phospho-N-acetylmuramoyl-pentapeptide-transf... | 28 | 8.9 |
|---|
>MTR_NEUCR (P38680) N amino acid transport system protein (Methyltryptophan| resistance protein) Length = 470 Score = 35.8 bits (81), Expect = 0.056 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = -3 Query: 423 IVSTVLAISLPFFNDILGLLGALGFWPLTVYFPVEMY--ISQSKMKKYSRKW 274 +++ V+A ++PFF+D+L + AL + YFP MY I+++ K +K+ Sbjct: 372 LIAWVIAEAIPFFSDLLAICSALFISGFSFYFPALMYFKITRNDAKSQGKKY 423
>UNC47_CAEEL (P34579) Vesicular GABA transporter (Uncoordinated protein 47)| (Protein unc-47) Length = 486 Score = 30.4 bits (67), Expect = 2.3 Identities = 14/66 (21%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = -3 Query: 465 SLNMFRLVWRTAFVIVSTVLAISLPFFNDILGLLGALGFWPLTVYFPV--EMYISQSKMK 292 SL + + R V+ + +A+S+P+ +++GL+G + L+ +P +YI + + Sbjct: 389 SLREWAVTLRIILVLFTLFVALSVPYLVELMGLVGNITGTMLSFIWPALFHLYIKEKTLN 448 Query: 291 KYSRKW 274 + +++ Sbjct: 449 NFEKRF 454
>S36A1_MOUSE (Q8K4D3) Proton-coupled amino acid transporter 1 (Proton/amino acid| transporter 1) (Solute carrier family 36 member 1) Length = 475 Score = 28.9 bits (63), Expect = 6.8 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -3 Query: 456 MFRLVWRTAFVIVSTVLAISLPFFNDILGLLGALGFWPLTVYFP 325 M L RTA V V+ VLAI +P + ++ L+G++ L + P Sbjct: 372 MVDLCVRTAMVCVTCVLAILIPRLDLVISLVGSVSSSALALIIP 415
>LIAF_BACSU (O32199) Protein liaF| Length = 241 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -3 Query: 411 VLAISLPFFNDILGLLGALGFWPLTVYFPVEMYISQSKMKKYSRKWV 271 + + F I+G+ G L FWPL +F + Y +KKYSR W+ Sbjct: 11 IALFGISMFLQIIGI-GDLLFWPL--FFLIAGYF----LKKYSRDWL 50
>MRAY_CHRVO (Q7NPZ6) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 361 Score = 28.5 bits (62), Expect = 8.9 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 11/52 (21%) Frame = -3 Query: 453 FRLVWRTAFVIVSTVLAIS-----------LPFFNDILGLLGALGFWPLTVY 331 F++ W++A I + V I+ +PFF + LGA+GF LT + Sbjct: 132 FKMAWQSAIAIGAGVFLIATAKLPASTELIVPFFKTVAYPLGAVGFCVLTYF 183 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,752,533 Number of Sequences: 219361 Number of extensions: 767915 Number of successful extensions: 2128 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2072 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2125 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)