| Clone Name | rbaet13d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YAB9_SCHPO (Q09809) Hypothetical protein C2G11.09 in chromosome I | 30 | 1.3 |
|---|
>YAB9_SCHPO (Q09809) Hypothetical protein C2G11.09 in chromosome I| Length = 796 Score = 30.4 bits (67), Expect = 1.3 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = -2 Query: 177 SDFRLSFWLL*SSRPGYCYFE*TISSRWFAASAPMSVLFGENLSQLINKHFFYL 16 SD R FWL C F RW AP + + G NL L + ++ +L Sbjct: 22 SDLRTQFWLAFLLGASACVFFCFFRKRWKVLYAPRTTIEGLNLPTLSSSYYKWL 75 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,795,005 Number of Sequences: 219361 Number of extensions: 397121 Number of successful extensions: 964 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)