| Clone Name | rbaet13d02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTR_NEUCR (P38680) N amino acid transport system protein (Methyl... | 34 | 0.12 | 2 | LIAF_BACSU (O32199) Protein liaF | 28 | 6.4 | 3 | YAN2_SCHPO (Q10068) Hypothetical protein C3H1.02c in chromosome I | 28 | 8.3 |
|---|
>MTR_NEUCR (P38680) N amino acid transport system protein (Methyltryptophan| resistance protein) Length = 470 Score = 34.3 bits (77), Expect = 0.12 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = -1 Query: 411 VLAISLPFFNDILGLLGALGFWPLTVYFPVEMY--ISQSKMKKYSRKW 274 V+A ++PFF+D+L + AL + YFP MY I+++ K +K+ Sbjct: 376 VIAEAIPFFSDLLAICSALFISGFSFYFPALMYFKITRNDAKSQGKKY 423
>LIAF_BACSU (O32199) Protein liaF| Length = 241 Score = 28.5 bits (62), Expect = 6.4 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -1 Query: 411 VLAISLPFFNDILGLLGALGFWPLTVYFPVEMYISQSKMKKYSRKWV 271 + + F I+G+ G L FWPL +F + Y +KKYSR W+ Sbjct: 11 IALFGISMFLQIIGI-GDLLFWPL--FFLIAGYF----LKKYSRDWL 50
>YAN2_SCHPO (Q10068) Hypothetical protein C3H1.02c in chromosome I| Length = 1036 Score = 28.1 bits (61), Expect = 8.3 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = +2 Query: 41 KISITQIQSTDDELFLEKNLKQTQ---VNESLLNS*ANHPIHNLVLNGT*FLSDWVMPW 208 K+SI +I+ E+++ N+ +NES L S A+ + ++ NG W PW Sbjct: 193 KLSIEKIREYHKEMYVPSNICLIVTGCINESRLLSCASGIVKEILANGIITPPTWTRPW 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,168,767 Number of Sequences: 219361 Number of extensions: 641479 Number of successful extensions: 1488 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1488 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)