| Clone Name | rbaet12a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | K0133_HUMAN (Q14146) Protein KIAA0133 | 29 | 3.5 | 2 | YEHY_ECOLI (P33361) Inner membrane ABC transporter permease prot... | 28 | 5.9 | 3 | CFT2_YEAST (Q12102) Protein CFT2 (Cleavage factor two protein 2)... | 28 | 5.9 | 4 | NU153_HUMAN (P49790) Nuclear pore complex protein Nup153 (Nucleo... | 28 | 7.7 |
|---|
>K0133_HUMAN (Q14146) Protein KIAA0133| Length = 1524 Score = 28.9 bits (63), Expect = 3.5 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = -2 Query: 185 GAVLYTCLKPAVHDIVCCSVLFLFITIILLWNNGGECKTGGCWCVQGRSRNCL 27 GAVL C P SVL ++ +L + G C+ GG QG R L Sbjct: 1096 GAVLQLCSVPGARGWRLPSVLISSVSTLLEADLGQHCRDGGADISQGSDRTLL 1148
>YEHY_ECOLI (P33361) Inner membrane ABC transporter permease protein yehY| Length = 385 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 194 GDGGAVLYTCLKPAVHDIVCCSVLFLFITIILLWNNG 84 G G A L C P +C +L F+ ++L+W G Sbjct: 54 GVGCAWLTACFIPGKKGSICALILAQFVFVLLVWGAG 90
>CFT2_YEAST (Q12102) Protein CFT2 (Cleavage factor two protein 2) (105 kDa| protein associated with polyadenylation factor I) Length = 859 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 107 IILLWNNGGECKTGGCWCVQGRSRNCLYSK 18 + LL N G C G WC+ S +Y+K Sbjct: 149 LTLLAYNAGVCPGGSIWCISTYSEKLVYAK 178
>NU153_HUMAN (P49790) Nuclear pore complex protein Nup153 (Nucleoporin Nup153)| (153 kDa nucleoporin) Length = 1475 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 139 TISWTAGFRQV*STAPPSPRSGPCFGVNQS 228 T S +AG V T P +P + P FG NQ+ Sbjct: 1295 TTSSSAGSSFVFGTGPSAPSASPAFGANQT 1324 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,503,340 Number of Sequences: 219361 Number of extensions: 814772 Number of successful extensions: 2183 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2183 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)