| Clone Name | rbaet125e01 |
|---|---|
| Clone Library Name | barley_pub |
>PGRP3_HOLDI (Q765P2) Peptidoglycan-recognition protein 3 precursor (Hd-PGRP-3)| Length = 187 Score = 29.6 bits (65), Expect = 1.9 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 7/65 (10%) Frame = +1 Query: 169 APKVAPQNESMEFARL*HLIYP-------CTMSQVYSHERSMHVARRGDLGEMYVLNGDH 327 A KV P + +++ + H P C+ VY R M+ D+G +++ GD Sbjct: 35 ARKVEPTTKPLKYVIINHTSGPSCVDEIDCSRMLVYIQNRHMNHLNYNDIGCNFIIGGDG 94 Query: 328 VMYSG 342 +Y G Sbjct: 95 QIYEG 99
>YFK9_YEAST (P43611) Hypothetical 59.4 kDa protein in CDC26-SAP155 intergenic| region Length = 510 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -3 Query: 120 RYNNIEINRVMELFFRFSI-ILSLMRL-ELCTRIH 22 RY N + R+M F+RF I S +RL ELC +H Sbjct: 78 RYPNSSLKRIMGYFYRFWYNIFSFLRLNELCCSLH 112
>FINC_PLEWA (Q91289) Fibronectin (FN) (Fragment)| Length = 1328 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 198 NGICKIVTPDLPLYYVTGLQP*T 266 N I + ++PDL Y +TGLQP T Sbjct: 792 NPIQRTISPDLRTYVITGLQPGT 814
>ASSY_ARATH (Q9SZX3) Argininosuccinate synthase, chloroplast precursor (EC| 6.3.4.5) (Citrulline--aspartate ligase) Length = 494 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/44 (27%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = +1 Query: 175 KVAPQNESMEFARL*HLIYPCTMSQVYSHERSM-HVARRGDLGE 303 ++ + +++E+A+ ++ P T +YS +R++ H++ GDL E Sbjct: 243 EIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDLLE 286
>CWC22_YARLI (Q6C8C5) Pre-mRNA-splicing factor CWC22| Length = 954 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 357 HMCTPATVHDMITIQHIHLT*VTPTRH 277 H+C H+++ +Q +HL TPT H Sbjct: 323 HLCNYHVAHEVLVLQLLHLLLETPTDH 349
>R1B12_SOLDE (Q6L3Z4) Putative late blight resistance protein homolog R1B-12| Length = 1296 Score = 27.3 bits (59), Expect = 9.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 363 YLHMCTPATVHDMITIQHIHL 301 YL + P TV DM+ ++H+H+ Sbjct: 984 YLRLLQPNTVWDMVKLRHLHI 1004
>PAC1_YEAST (P39946) Protein PAC1 (LIS-1 homolog)| Length = 494 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 6/59 (10%) Frame = -2 Query: 181 LLWVPS*SLSCMRTLTGTVQQVQQHRDQPC------HGVIFSLQHYFVTHEIGIVHSHT 23 L W+P SC+ + +V V+ H + P HG +++ + T + + SHT Sbjct: 140 LKWIPRNLPSCLINVESSVTSVKLHPNLPIVFVATDHGKLYAFDLFNYTIPLASLQSHT 198 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,163,235 Number of Sequences: 219361 Number of extensions: 850842 Number of successful extensions: 1657 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1657 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)