| Clone Name | rbaet125a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BOLA_HAEIN (P43780) Protein bolA homolog | 29 | 2.7 | 2 | IDH1_YEAST (P28834) Isocitrate dehydrogenase [NAD] subunit 1, mi... | 28 | 6.1 |
|---|
>BOLA_HAEIN (P43780) Protein bolA homolog| Length = 103 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +3 Query: 15 ISQSYERIRGLQRNKISYKILSHTTHHSMHVL 110 +S ++ IR +QR++ Y++L+ +HS+H L Sbjct: 44 VSADFKNIRKVQRHQRIYQLLNEELNHSIHAL 75
>IDH1_YEAST (P28834) Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial| precursor (EC 1.1.1.41) (Isocitric dehydrogenase) (NAD(+)-specific ICDH) Length = 360 Score = 28.1 bits (61), Expect = 6.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +3 Query: 27 YERIRGLQRNKISYKILSHTT-----HHSMHVLLKVHLN 128 YE + L+RNKI K L HT H S++V L+ L+ Sbjct: 75 YEAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLD 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,693,985 Number of Sequences: 219361 Number of extensions: 653527 Number of successful extensions: 1376 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1376 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)