| Clone Name | rbaet124h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CON8_NEUCR (P10169) Conidiation-specific protein 8 | 30 | 1.3 | 2 | STCB_EMENI (Q12608) Probable sterigmatocystin biosynthesis P450 ... | 29 | 2.8 | 3 | SOX_ARATH (Q9SJA7) Probable sarcosine oxidase (EC 1.5.3.1) | 29 | 3.7 | 4 | SEPA_EMENI (P78621) Cytokinesis protein sepA (FH1/2 protein) (Fo... | 29 | 3.7 |
|---|
>CON8_NEUCR (P10169) Conidiation-specific protein 8| Length = 176 Score = 30.4 bits (67), Expect = 1.3 Identities = 18/42 (42%), Positives = 20/42 (47%) Frame = -2 Query: 231 RRRRPAWSSSTTGSDGSRAIRWGTPRVTDVGNGRRSRHLHRG 106 R R A +SSTT GS VT+V GRR H H G Sbjct: 85 RSERSASTSSTTSETGSDRPMGSASTVTEVPYGRRPSHGHGG 126
>STCB_EMENI (Q12608) Probable sterigmatocystin biosynthesis P450 monooxygenase| STCB (EC 1.14.-.-) (Cytochrome P450 62) Length = 435 Score = 29.3 bits (64), Expect = 2.8 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 118 PSPWLC-LTPAIANWSVFANNLLH 50 P PW LT +WSVFANN +H Sbjct: 31 PGPWYASLTGLRLSWSVFANNRIH 54
>SOX_ARATH (Q9SJA7) Probable sarcosine oxidase (EC 1.5.3.1)| Length = 416 Score = 28.9 bits (63), Expect = 3.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -1 Query: 229 AAEAGLELEHYRIGRFEGNPMGNATSH 149 A G+E++ + + RFE NP GNA + Sbjct: 378 AGGGGVEMKQFSLRRFEDNPKGNAKEY 404
>SEPA_EMENI (P78621) Cytokinesis protein sepA (FH1/2 protein) (Forced| expression inhibition of growth A) Length = 1790 Score = 28.9 bits (63), Expect = 3.7 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -2 Query: 216 AWSSSTTGSDGSRAIRWGTPRVTDVGNGRRSRH 118 A SSS TG G+R +WG P + GN S H Sbjct: 158 AMSSSATGDKGARYQQWGRPG-SSAGNAGLSHH 189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.128 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,203,985 Number of Sequences: 219361 Number of extensions: 745892 Number of successful extensions: 1825 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1825 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)