| Clone Name | rbaet124g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YVAU_VACCC (P20530) Hypothetical 8.8 kDa protein | 30 | 1.6 | 2 | XIST_MOUSE (P27571) X inactive-specific transcript protein (Frag... | 28 | 6.0 |
|---|
>YVAU_VACCC (P20530) Hypothetical 8.8 kDa protein| Length = 72 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = -2 Query: 248 SVRACSYFSSCRFCLYLFVRWC*STCVVNCVAAQPWRTRSFTYR 117 S+ C + C +C+ C C++ + + +R+R F YR Sbjct: 12 SLVCCGFSRCCTYCINAITSVCDGVCMIFYIISNWFRSRDFEYR 55
>XIST_MOUSE (P27571) X inactive-specific transcript protein (Fragment)| Length = 298 Score = 28.1 bits (61), Expect = 6.0 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = -1 Query: 174 VCC*LCSCSAMADPQLYLQILSLYFGVNYANT----TWLLFCLYYCLC 43 +C LC ++ L I SLY V+ + +W+ C+Y C+C Sbjct: 238 LCVCLCFYLLLSSFLFTLSISSLYKSVSLLYSKVILSWMFLCMYMCVC 285 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,467,359 Number of Sequences: 219361 Number of extensions: 650790 Number of successful extensions: 1769 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1768 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)