| Clone Name | rbaet124f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VE5_RHPV1 (P24834) Probable protein E5 | 32 | 0.52 | 2 | RAD16_YEAST (P31244) DNA repair protein RAD16 (EC 3.6.1.-) (ATP-... | 29 | 2.6 | 3 | NUP84_YEAST (P52891) Nucleoporin NUP84 (Nuclear pore protein NUP84) | 28 | 4.4 |
|---|
>VE5_RHPV1 (P24834) Probable protein E5| Length = 157 Score = 31.6 bits (70), Expect = 0.52 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -2 Query: 246 FRLARCCCYCIIKRSLHIREH*FVVF-VCLSV 154 F L CCC+C+ +H+ F VF VCLSV Sbjct: 42 FWLCFCCCFCLALCFVHLLSRCFCVFPVCLSV 73
>RAD16_YEAST (P31244) DNA repair protein RAD16 (EC 3.6.1.-) (ATP-dependent| helicase RAD16) Length = 790 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 69 FGDRNGHFVLPLPCHAMLLYRVIQEEANRQTDRQTQQINVLLYVET 206 F +NG F P H + YRVI +EA+ DRQ+ + ++T Sbjct: 298 FRRKNGLFKQPSVLHNIDFYRVILDEAHNIKDRQSNTARAVNNLKT 343
>NUP84_YEAST (P52891) Nucleoporin NUP84 (Nuclear pore protein NUP84)| Length = 726 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 93 VLPLPCHAMLLYRVIQEEANRQTDRQTQQINVLL 194 +LPLP HA+ + V+ A+R I VL+ Sbjct: 314 ILPLPSHALTVQEVLNRVASRHPSESEHPIRVLM 347 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,165,573 Number of Sequences: 219361 Number of extensions: 713472 Number of successful extensions: 1629 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1629 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)