ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet124f10 |
|---|---|
| Clone Library Name | barley_pub |
>POR_AVESA (P15904) Protochlorophyllide reductase (EC 1.3.1.33) (PCR)| (NADPH-protochlorophyllide oxidoreductase) (POR) (Fragment) Length = 313 Score = 71.6 bits (174), Expect = 4e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 232 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA Sbjct: 279 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 313
>PORA_WHEAT (Q41578) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 71.6 bits (174), Expect = 4e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 232 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA Sbjct: 354 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 388
>PORA_HORVU (P13653) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 71.6 bits (174), Expect = 4e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 232 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA Sbjct: 354 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 388
>PORA_CUCSA (Q41249) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 398 Score = 66.6 bits (161), Expect = 1e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 232 NK+SASFENQLSQEASD EKARKVWELSEKLVGLA Sbjct: 364 NKNSASFENQLSQEASDAEKARKVWELSEKLVGLA 398
>POR_DAUCA (Q9SDT1) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 398 Score = 65.9 bits (159), Expect = 2e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 232 NKDSASFENQLS+EASD EKARKVWE+SEKLVGLA Sbjct: 364 NKDSASFENQLSEEASDVEKARKVWEVSEKLVGLA 398
>PORB_HORVU (Q42850) Protochlorophyllide reductase B, chloroplast precursor (EC| 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) Length = 395 Score = 65.5 bits (158), Expect = 3e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 232 NK+SASFENQLS+EASD EKARKVWELSEKLVGLA Sbjct: 361 NKNSASFENQLSEEASDTEKARKVWELSEKLVGLA 395
>PORA_ARATH (Q42536) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 405 Score = 63.2 bits (152), Expect = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 232 NK SASFENQLSQEASD EKAR+VWE+SEKLVGLA Sbjct: 371 NKTSASFENQLSQEASDVEKARRVWEVSEKLVGLA 405
>POR_PEA (Q01289) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 399 Score = 62.4 bits (150), Expect = 3e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 232 N SASFENQLSQEASD EKARKVWE+SEKLVGLA Sbjct: 365 NNASASFENQLSQEASDAEKARKVWEVSEKLVGLA 399
>PORB_ARATH (P21218) Protochlorophyllide reductase B, chloroplast precursor (EC| 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) Length = 401 Score = 61.2 bits (147), Expect = 6e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 232 N SASFENQLS+EASD EKARKVWE+SEKLVGLA Sbjct: 367 NNASASFENQLSEEASDVEKARKVWEISEKLVGLA 401
>PORC_ARATH (O48741) Protochlorophyllide reductase C, chloroplast precursor (EC| 1.3.1.33) (PCR C) (NADPH-protochlorophyllide oxidoreductase C) (POR C) Length = 401 Score = 58.5 bits (140), Expect = 4e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGLA 232 N +S+SFENQLS+EASD EKA+K+WE+SEKLVGLA Sbjct: 367 NNNSSSFENQLSKEASDAEKAKKLWEVSEKLVGLA 401
>POR_MARPA (O80333) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 458 Score = 57.4 bits (137), Expect = 9e-09 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -1 Query: 336 NKDSASFENQLSQEASDPEKARKVWELSEKLVGL 235 NKDS SFEN+LS+EAS+PEKA+++WELSE+L GL Sbjct: 424 NKDSGSFENELSEEASNPEKAKRLWELSERLSGL 457
>POR_CHLRE (Q39617) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 397 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/32 (53%), Positives = 26/32 (81%) Frame = -1 Query: 327 SASFENQLSQEASDPEKARKVWELSEKLVGLA 232 + SF+NQ+S+E +D KA K+W++S KLVGL+ Sbjct: 365 TGSFDNQVSEEVADDSKASKLWDISAKLVGLS 396
>POR_PLEBO (O66148) Light-dependent protochlorophyllide reductase (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) (LPOR) Length = 322 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/30 (60%), Positives = 25/30 (83%) Frame = -1 Query: 321 SFENQLSQEASDPEKARKVWELSEKLVGLA 232 SF +LS++ +D KA+++WELSEKLVGLA Sbjct: 293 SFVQELSEKVTDDAKAKRMWELSEKLVGLA 322
>POR_SYNY3 (Q59987) Light-dependent protochlorophyllide reductase (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) (LPOR) Length = 322 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/29 (55%), Positives = 25/29 (86%) Frame = -1 Query: 321 SFENQLSQEASDPEKARKVWELSEKLVGL 235 +F +LS++ SD +KA+++W+LSEKLVGL Sbjct: 293 AFVQELSEQGSDAQKAQRMWDLSEKLVGL 321
>RDH13_MOUSE (Q8CEE7) Retinol dehydrogenase 13 (EC 1.1.1.-)| Length = 334 Score = 31.6 bits (70), Expect = 0.51 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -1 Query: 315 ENQLSQEASDPEKARKVWELSEKLVGLA*STANP 214 E S EA D E AR++W S +LVGLA + +P Sbjct: 293 EKAPSPEAEDEEVARRLWTESARLVGLAMAHGSP 326
>RDH14_HUMAN (Q9HBH5) Retinol dehydrogenase 14 (EC 1.1.1.-) (Alcohol| dehydrogenase PAN2) Length = 336 Score = 30.8 bits (68), Expect = 0.88 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 315 ENQLSQEASDPEKARKVWELSEKLVGL 235 E +L +A D ARK+W++SE +VGL Sbjct: 308 EEELLPKAMDESVARKLWDISEVMVGL 334
>GANA_HUMIN (P83691) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 107 QERPCEWPRECIDLVWKMYNFRQTLE**NRRPD*G 3 Q P WP + +L WK+YN+ TL+ NR D G Sbjct: 92 QTTPAGWPSDINNLAWKLYNY--TLDSMNRFADAG 124
>RDH14_MOUSE (Q9ERI6) Retinol dehydrogenase 14 (EC 1.1.1.-) (Alcohol| dehydrogenase PAN2) Length = 334 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -1 Query: 315 ENQLSQEASDPEKARKVWELSEKLVGL 235 E +L +A D ARK+W++SE +VG+ Sbjct: 306 EEELLPKAMDESVARKLWDISEVMVGI 332
>ATXR3_ARATH (O23372) Probable histone-lysine N-methyltransferase ATXR3 (EC| 2.1.1.43) (Trithorax-related protein 3) (TRX-related protein 3) (Protein SET DOMAIN GROUP 2) Length = 2351 Score = 29.6 bits (65), Expect = 2.0 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = +1 Query: 25 YYSNVCRKLYIFHTRSMHSRGHSQGLSCVIELLKRRKHDNHQISLKKRQVEHRPAS 192 Y S+ CRKL +RS+HS +SQ + E L R + + SL+K +H+ AS Sbjct: 322 YGSSKCRKLSDDCSRSLHSDHYSQHSA---ERLYRDSYPSKNSSLEKYPRKHQDAS 374
>WWOX_MOUSE (Q91WL8) WW domain-containing oxidoreductase (EC 1.1.1.-)| Length = 414 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 303 SQEASDPEKARKVWELSEKLV 241 S+EA E AR +WELSE+L+ Sbjct: 385 SEEAQSEETARALWELSERLI 405
>RL10_HALMA (P60617) 50S ribosomal protein L10e| Length = 177 Score = 28.9 bits (63), Expect = 3.3 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -3 Query: 214 HGCMHASRTPADAQLVVFLNLFGDYH--VYAFLEAQLRRRGLASGRESA*ISCGRCTIFG 41 HG + ASR A+ L+ L GDY + F LR A+G + +S G FG Sbjct: 62 HGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFG 121 Query: 40 K 38 K Sbjct: 122 K 122
>TIE2_BRARE (O73791) Tyrosine-protein kinase receptor Tie-2 precursor (EC| 2.7.10.1) Length = 1116 Score = 28.9 bits (63), Expect = 3.3 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +2 Query: 185 RRPRCMHASMGFAVDHASPTSFSLSSQTLRAFSGSLASWESWFSK 319 R+ R + FA+ H T+ +LSSQ L AFS +A S+ S+ Sbjct: 907 RKSRVLETDPAFAIAHR--TASTLSSQQLLAFSADVARGMSYLSQ 949
>WWOX_BRARE (Q803A8) WW domain-containing oxidoreductase (EC 1.1.1.-)| Length = 412 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 303 SQEASDPEKARKVWELSEKLV 241 S +A DP A +WELSE+LV Sbjct: 382 SPQAQDPAAALSLWELSERLV 402
>NIFK_THIFE (P15052) Nitrogenase molybdenum-iron protein beta chain (EC| 1.18.6.1) (Nitrogenase component I) (Dinitrogenase) Length = 518 Score = 28.5 bits (62), Expect = 4.3 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 321 SFENQL-SQEASDPEKARKVWELSEKLVGLA*STANPMDACMHLGR 187 +FEN+L + + + ++ K WE EK + NP AC LGR Sbjct: 30 TFENRLPADQVARGQEWTKTWEYREKNFAREALSVNPDKACQPLGR 75
>DHAK_ECOLI (P76015) PTS-dependent dihydroxyacetone kinase,| dihydroxyacetone-binding subunit dhaK (EC 2.7.-.-) Length = 366 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -1 Query: 258 LSEKLVGLA*STANPMDACMHLGRR 184 L EKLVG A + +DAC LGR+ Sbjct: 165 LIEKLVGAAAERGDSLDACAELGRK 189
>GANA_THIHE (P83692) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 27.7 bits (60), Expect = 7.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 107 QERPCEWPRECIDLVWKMYNF 45 Q P WP + +L WK+YN+ Sbjct: 92 QTMPAGWPSDIDNLSWKLYNY 112
>CTPI_MYCTU (Q10900) Probable cation-transporting ATPase I (EC 3.6.3.-)| Length = 1625 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +2 Query: 191 PRCMHASMGFAVDHASPTSFSLSSQTLRAFSGSLASWESWFSKDAES 331 PRC A G +HA L+ Q LR + + +W++ + D E+ Sbjct: 1175 PRCRLADPGVDHEHAESVVRHLAEQGLRVLAVAQRTWDNGTTHDDET 1221
>HRP1_SCHPO (Q9US25) Chromodomain helicase hrp1 (EC 3.6.1.-) (ATP-dependent| helicase hrp1) Length = 1373 Score = 23.5 bits (49), Expect(2) = 8.6 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 25 YYSNVCRKLYIFHTRSMHSRGHSQGLSCVIELLKRRKH 138 +Y N+ K Y T RG L+ V+EL K H Sbjct: 636 WYKNILTKNYRALTGHTDGRGQLSLLNIVVELKKVSNH 673 Score = 22.3 bits (46), Expect(2) = 8.6 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 115 ELLKRRKHDNHQISLKKRQV 174 +LL+R KHD H++ + + V Sbjct: 711 KLLQRLKHDGHRVLIFSQMV 730
>RPOB_STRPM (Q48VR1) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = -3 Query: 253 REARRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGDYHVYAFLEAQLRRRGLASGR 83 R R +H +G M TP + + NL FG + Y F++ R+ A+GR Sbjct: 502 RAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGR 560
>RPOB_STRP6 (Q5XE97) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = -3 Query: 253 REARRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGDYHVYAFLEAQLRRRGLASGR 83 R R +H +G M TP + + NL FG + Y F++ R+ A+GR Sbjct: 502 RAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGR 560
>RPOB_STRP3 (Q8K8W3) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = -3 Query: 253 REARRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGDYHVYAFLEAQLRRRGLASGR 83 R R +H +G M TP + + NL FG + Y F++ R+ A+GR Sbjct: 502 RAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGR 560
>RDH13_HUMAN (Q8NBN7) Retinol dehydrogenase 13 (EC 1.1.1.-)| Length = 331 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 297 EASDPEKARKVWELSEKLVGL 235 EA D E AR++W S +LVGL Sbjct: 299 EAEDEEVARRLWAESARLVGL 319 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,757,864 Number of Sequences: 219361 Number of extensions: 724954 Number of successful extensions: 2130 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 2100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2129 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
