| Clone Name | rbaet123h03 |
|---|---|
| Clone Library Name | barley_pub |
>H2B2_WHEAT (P05621) Histone H2B.2| Length = 149 Score = 94.0 bits (232), Expect = 9e-20 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 102 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 149
>H2B1_MAIZE (P30755) Histone H2B.1| Length = 151 Score = 94.0 bits (232), Expect = 9e-20 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 104 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 151
>H2B3_MAIZE (Q43261) Histone H2B.3| Length = 153 Score = 93.6 bits (231), Expect = 1e-19 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 SAKLARYNKKPT+TSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 106 SAKLARYNKKPTVTSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 153
>H2B2_MAIZE (P30756) Histone H2B.2| Length = 150 Score = 92.8 bits (229), Expect = 2e-19 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +AKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 103 AAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 150
>H2B1_WHEAT (P27807) Histone H2B| Length = 152 Score = 92.8 bits (229), Expect = 2e-19 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +AKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 105 AAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 152
>H2B4_MAIZE (P49120) Histone H2B.4| Length = 137 Score = 92.8 bits (229), Expect = 2e-19 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +AKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 90 AAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 137
>H2B5_MAIZE (P54348) Histone H2B| Length = 154 Score = 92.8 bits (229), Expect = 2e-19 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +AKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 107 AAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 154
>H2B_ARATH (P40283) Histone H2B| Length = 150 Score = 90.5 bits (223), Expect = 1e-18 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLARYNKKPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 103 ASKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 150
>H2B_CAPAN (O49118) Histone H2B (CaH2B)| Length = 145 Score = 90.5 bits (223), Expect = 1e-18 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 S++LARYNKKPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 98 SSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 145
>H2B_GOSHI (O22582) Histone H2B| Length = 147 Score = 89.4 bits (220), Expect = 2e-18 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LARYNKKPTITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 100 ASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 147
>H2B3_VOLCA (P16867) Histone H2B-III| Length = 157 Score = 87.8 bits (216), Expect = 6e-18 Identities = 42/48 (87%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KL+RYNKKPT+TSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 110 ASKLSRYNKKPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 157
>H2B4_VOLCA (P16868) Histone H2B-IV| Length = 155 Score = 87.8 bits (216), Expect = 6e-18 Identities = 42/48 (87%), Positives = 48/48 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KL+RYNKKPT+TSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 108 ASKLSRYNKKPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA 155
>H2B4_CHLRE (P54347) Histone H2B-IV| Length = 153 Score = 87.4 bits (215), Expect = 8e-18 Identities = 42/47 (89%), Positives = 47/47 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTS 177 ++KL+RYNKKPT+TSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 106 ASKLSRYNKKPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152
>H2B3_CHLRE (P54346) Histone H2B-III| Length = 153 Score = 87.4 bits (215), Expect = 8e-18 Identities = 42/47 (89%), Positives = 47/47 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTS 177 ++KL+RYNKKPT+TSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 106 ASKLSRYNKKPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152
>H2B1_CHLRE (P50565) Histone H2B-I| Length = 153 Score = 87.4 bits (215), Expect = 8e-18 Identities = 42/47 (89%), Positives = 47/47 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTS 177 ++KL+RYNKKPT+TSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 106 ASKLSRYNKKPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 152
>H2B2_CHLRE (P54345) Histone H2B-II| Length = 156 Score = 87.4 bits (215), Expect = 8e-18 Identities = 42/47 (89%), Positives = 47/47 (100%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTS 177 ++KL+RYNKKPT+TSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS Sbjct: 109 ASKLSRYNKKPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 155
>H2B_TOBAC (P93354) Histone H2B| Length = 146 Score = 86.3 bits (212), Expect = 2e-17 Identities = 43/48 (89%), Positives = 47/48 (97%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 S++LA YNKKPTI+SREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 99 SSRLAGYNKKPTISSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 146
>H2B_SALTR (P69070) Histone H2B| Length = 123 Score = 82.0 bits (201), Expect = 3e-16 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 S++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 75 SSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122
>H2B_ONCMY (P69069) Histone H2B| Length = 123 Score = 82.0 bits (201), Expect = 3e-16 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 S++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 75 SSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122
>H2B_ROSNE (Q8J1K2) Histone H2B| Length = 136 Score = 81.6 bits (200), Expect = 4e-16 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI+SREIQTSVRL+LPGELAKHAVSEGTKAVTK++SS Sbjct: 87 ASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSS 134
>H2B_NEUCR (P37210) Histone H2B| Length = 137 Score = 81.6 bits (200), Expect = 4e-16 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI+SREIQTSVRL+LPGELAKHAVSEGTKAVTK++SS Sbjct: 88 ASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSS 135
>H2B_AJECA (Q7Z9J4) Histone H2B| Length = 137 Score = 81.6 bits (200), Expect = 4e-16 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI+SREIQTSVRL+LPGELAKHAVSEGTKAVTK++SS Sbjct: 88 ASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSS 135
>H2B2_PSAMI (P02288) Histone H2B.2, embryonic| Length = 122 Score = 81.6 bits (200), Expect = 4e-16 Identities = 39/48 (81%), Positives = 47/48 (97%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 S++LA+YNKK TI+SREIQT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 74 SSRLAQYNKKSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTTS 121
>H2BE_STRPU (P02289) Histone H2B, embryonic| Length = 123 Score = 81.6 bits (200), Expect = 4e-16 Identities = 39/48 (81%), Positives = 47/48 (97%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 S++LA+YNKK TI+SREIQT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 75 SSRLAQYNKKSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTTS 122
>H2B_EMENI (P23754) Histone H2B| Length = 139 Score = 81.6 bits (200), Expect = 4e-16 Identities = 40/48 (83%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI+SREIQTSVRL+LPGELAKHAVSEGTKAVTK++SS Sbjct: 90 ASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSS 137
>H2BT_RAT (Q00729) Histone H2B, testis (Testis-specific histone H2B)| Length = 126 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 78 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125
>H2BT_MOUSE (P70696) Histone H2B, testis (Testis-specific histone H2B)| Length = 126 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 78 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125
>H2B_CHICK (P02279) Histone H2B| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2B_BOVIN (P62808) Histone H2B| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BQ_HUMAN (Q16778) Histone H2B.q (H2B/q) (H2B-GL105)| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BN_HUMAN (P23527) Histone H2B.n (H2B/n) (H2B.2)| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BJ_HUMAN (Q93079) Histone H2B.j (H2B/j)| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BF_HUMAN (P33778) Histone H2B.f (H2B/f) (H2B.1)| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BE_HUMAN (Q99879) Histone H2B.e (H2B/e)| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BD_HUMAN (Q99877) Histone H2B.d (H2B/d)| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BC_HUMAN (Q99880) Histone H2B.c (H2B/c)| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BB_HUMAN (P58876) Histone H2B.b (H2B/b) (H2B.1 B) (HIRA-interacting protein| 2) Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BA_HUMAN (P62807) Histone H2B.a/g/h/k/l (H2B.1 A) (H2B/a) (H2B/g) (H2B/h)| (H2B/k) (H2B/l) Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2B2_MOUSE (P10854) Histone H2B 291B| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2B1_MOUSE (P10853) Histone H2B F (H2B 291A)| Length = 125 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2B_CHITH (P21897) Histone H2B| Length = 124 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 76 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 123
>H2B_PLADU (P19374) Histone H2B| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_PATGR (P02284) Histone H2B, gonadal| Length = 121 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 73 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 120
>H2B_DROYA (Q8I1N0) Histone H2B| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_DROTE (Q76FF3) Histone H2B| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_DROSI (P59782) Histone H2B| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_DROSE (Q76FD7) Histone H2B| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_DROOR (Q76FE9) Histone H2B| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_DROME (P02283) Histone H2B| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_DROMA (Q76FE5) Histone H2B| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_DROHY (P17271) Histone H2B| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_DROER (P59781) Histone H2B| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B3_TIGCA (P35069) Histone H2B.3| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B1_TIGCA (P35068) Histone H2B.1/H2B.2| Length = 122 Score = 80.9 bits (198), Expect = 8e-16 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_MARGL (P02285) Histone H2B, sperm| Length = 120 Score = 80.5 bits (197), Expect = 1e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNKK TITSRE+QT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 72 ASRLAHYNKKSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 119
>H2BX_HUMAN (Q8N257) Histone H2B type 12| Length = 125 Score = 80.5 bits (197), Expect = 1e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSRE+QT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BN_STRPU (P16889) Late histone H2B.L3| Length = 122 Score = 80.5 bits (197), Expect = 1e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNKK TITSRE+QT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 74 ASRLAHYNKKSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 121
>H2B_ASTRU (P02286) Histone H2B, gonadal| Length = 121 Score = 80.5 bits (197), Expect = 1e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNKK TITSRE+QT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 73 ASRLAHYNKKSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 120
>H2B_ASTPE (Q7M4G7) Histone H2B| Length = 121 Score = 80.5 bits (197), Expect = 1e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNKK TITSRE+QT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 73 ASRLAHYNKKSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 120
>H2B_ANOGA (Q27442) Histone H2B| Length = 123 Score = 80.5 bits (197), Expect = 1e-15 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 314 AKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 76 SRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122
>H2B_OLILU (P82887) Histone H2B| Length = 113 Score = 80.5 bits (197), Expect = 1e-15 Identities = 38/48 (79%), Positives = 47/48 (97%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LARYNK+ T++SREIQT+VRL+LPGELAKHAVSEGTKAVTKFTS+ Sbjct: 66 ASRLARYNKRSTLSSREIQTAVRLMLPGELAKHAVSEGTKAVTKFTSN 113
>H2B_EUPCR (O97484) Histone H2B| Length = 113 Score = 80.5 bits (197), Expect = 1e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KL RYNKK T++SRE+QT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 66 ASKLVRYNKKHTLSSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 113
>H2B_RAT (Q00715) Histone H2B| Length = 124 Score = 80.1 bits (196), Expect = 1e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -3 Query: 311 KLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 78 RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 123
>H2B4_CAEEL (Q27876) Probable histone H2B 4| Length = 122 Score = 80.1 bits (196), Expect = 1e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TI+SREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSS 121
>H2B3_CAEEL (Q27484) Probable histone H2B 3| Length = 122 Score = 80.1 bits (196), Expect = 1e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TI+SREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSS 121
>H2B2_CAEEL (Q27894) Histone H2B 2| Length = 122 Score = 80.1 bits (196), Expect = 1e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TI+SREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSS 121
>H2B1_CAEEL (P04255) Histone H2B 1| Length = 121 Score = 80.1 bits (196), Expect = 1e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TI+SREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 73 ASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSS 120
>H2B_RHASC (Q75VN4) Histone H2B| Length = 125 Score = 79.7 bits (195), Expect = 2e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TS+ Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA 124
>H2BR_HUMAN (P06899) Histone H2B.r (H2B/r) (H2B.1)| Length = 125 Score = 79.7 bits (195), Expect = 2e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TS+ Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA 124
>H2BK_HUMAN (O60814) Histone H2B K (HIRA-interacting protein 1)| Length = 125 Score = 79.7 bits (195), Expect = 2e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TS+ Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA 124
>H2B2_XENLA (P06900) Histone H2B.2| Length = 125 Score = 79.7 bits (195), Expect = 2e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TS+ Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA 124
>H2B1_XENLA (P02281) Histone H2B.1| Length = 125 Score = 79.7 bits (195), Expect = 2e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TS+ Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA 124
>H2B_SIPNU (P30757) Histone H2B| Length = 122 Score = 79.7 bits (195), Expect = 2e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YN++ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 74 ASRLAHYNRRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 121
>H2B_ACRFO (P35067) Histone H2B| Length = 125 Score = 79.3 bits (194), Expect = 2e-15 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 S++L+ YNKK TI+SREIQT++RL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 SSRLSLYNKKATISSREIQTAIRLLLPGELAKHAVSEGTKAVTKYTSS 124
>H2BL_STRPU (P16888) Late histone H2B.L1| Length = 122 Score = 79.3 bits (194), Expect = 2e-15 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNKK TITSRE+QT VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 74 ASRLAHYNKKSTITSREVQTVVRLLLPGELAKHAVSEGTKAVTKYTTS 121
>H2B_HOLTU (P48557) Histone H2B| Length = 123 Score = 79.3 bits (194), Expect = 2e-15 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YN+K TITSRE+QT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 75 ASRLAHYNRKSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 122
>H2BO_STRPU (P16890) Late histone H2B.L4 (Fragment)| Length = 107 Score = 79.3 bits (194), Expect = 2e-15 Identities = 37/48 (77%), Positives = 47/48 (97%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA+YNKK TI+SRE+QT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 59 ASRLAQYNKKSTISSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 106
>H2B3_PSAMI (P07794) Late histone H2B.2.1| Length = 123 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNKK TI+SRE+QT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 75 ASRLAHYNKKSTISSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 122
>H2B_CAIMO (P14001) Histone H2B| Length = 125 Score = 78.6 bits (192), Expect = 4e-15 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YNK+ TITSREIQT+VR +LPGELAKHAVSEGTKAVTK+TSS Sbjct: 77 ASRLAHYNKRSTITSREIQTAVRSLLPGELAKHAVSEGTKAVTKYTSS 124
>H2B1_SCHPO (P04913) Histone H2B-alpha (H2B.1)| Length = 125 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI+SREIQT+VRL+LPGELAKHAV+EGTK+VTK++SS Sbjct: 76 ASKLAAYNKKSTISSREIQTAVRLILPGELAKHAVTEGTKSVTKYSSS 123
>H2B1_ASHGO (Q74ZL5) Histone H2B.1| Length = 132 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI++REIQT+VRL+LPGELAKHAVSEGT+AVTK++SS Sbjct: 82 ASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 129
>H2B_URECA (P27326) Histone H2B| Length = 122 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA YN++ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+T S Sbjct: 74 ASRLAHYNRRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTQS 121
>H2B4_PSAMI (P07795) Late histone H2B.2.2| Length = 123 Score = 78.2 bits (191), Expect = 5e-15 Identities = 36/48 (75%), Positives = 47/48 (97%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++L++YNKK TI+SRE+QT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 75 ASRLSQYNKKSTISSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 122
>H2B2_ASHGO (Q8J1F8) Histone H2B.2| Length = 127 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI++REIQT+VRL+LPGELAKHAVSEGT+AVTK++SS Sbjct: 77 ASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 124
>H2B2_YEAST (P02294) Histone H2B.2| Length = 130 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI++REIQT+VRL+LPGELAKHAVSEGT+AVTK++SS Sbjct: 80 ASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 127
>H2B2_CANGA (Q6FM30) Histone H2B.2| Length = 130 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI++REIQT+VRL+LPGELAKHAVSEGT+AVTK++SS Sbjct: 80 ASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 127
>H2B1_YEAST (P02293) Histone H2B.1| Length = 130 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI++REIQT+VRL+LPGELAKHAVSEGT+AVTK++SS Sbjct: 80 ASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 127
>H2B1_CANGA (Q6FWM8) Histone H2B.1| Length = 128 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI++REIQT+VRL+LPGELAKHAVSEGT+AVTK++SS Sbjct: 78 ASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 125
>H2B_AGABI (P78567) Histone H2B| Length = 143 Score = 77.8 bits (190), Expect = 6e-15 Identities = 37/47 (78%), Positives = 45/47 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTS 177 ++KLA Y+KK TI+SREIQTSVRL+LPGELAKHA+SEGTK+VTKF+S Sbjct: 94 ASKLASYSKKSTISSREIQTSVRLILPGELAKHAISEGTKSVTKFSS 140
>H2BS_HUMAN (P57053) Histone H2B.s (H2B/s)| Length = 125 Score = 77.8 bits (190), Expect = 6e-15 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++L YNK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+TS+ Sbjct: 77 ASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA 124
>H2BT_HUMAN (Q96A08) Histone H2B, testis (Testis-specific histone H2B)| Length = 126 Score = 77.4 bits (189), Expect = 8e-15 Identities = 37/48 (77%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++LA Y+K+ TI+SREIQT+VRL+LPGELAKHAVSEGTKAVTK+TSS Sbjct: 78 ASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 125
>H2B1_CANAL (P48989) Histone H2B.1| Length = 129 Score = 77.0 bits (188), Expect = 1e-14 Identities = 36/48 (75%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 ++KLA YNKK TI++REIQT+VRL+LPGELAKHAVSEGT+AVTK++S+ Sbjct: 80 ASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSA 127
>H2B1_PSAMI (P02287) Histone H2B.1, embryonic| Length = 122 Score = 77.0 bits (188), Expect = 1e-14 Identities = 36/48 (75%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++L +YNKK TI+SREIQT+VRL+LPGELAKHAVSEGTKAVTK+T++ Sbjct: 74 ASRLTQYNKKSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTTA 121
>H2B_PEA (Q99285) Histone H2B (Fragments)| Length = 119 Score = 76.3 bits (186), Expect = 2e-14 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTS 177 +++LARYNKK TIT REIQT+VRL+LPGE+AKH VSE TKAVTKFTS Sbjct: 71 ASRLARYNKKSTITPREIQTAVRLLLPGEVAKHKVSEATKAVTKFTS 117
>H2B_TETPY (Q7M400) Histone H2B| Length = 120 Score = 75.9 bits (185), Expect = 2e-14 Identities = 34/48 (70%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 S+KL R+NK+ T++SRE+QT+V+L+LPGELA+HA+SEGTKAVTKF+SS Sbjct: 71 SSKLVRFNKRRTLSSREVQTAVKLLLPGELARHAISEGTKAVTKFSSS 118
>H2B2_TETTH (P08994) Histone H2B.2 (H2B-2)| Length = 121 Score = 75.9 bits (185), Expect = 2e-14 Identities = 34/48 (70%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 S+KL R+NK+ T++SRE+QT+V+L+LPGELA+HA+SEGTKAVTKF+SS Sbjct: 72 SSKLVRFNKRRTLSSREVQTAVKLLLPGELARHAISEGTKAVTKFSSS 119
>H2B1_TETTH (P08993) Histone H2B.1 (H2B-1)| Length = 121 Score = 75.9 bits (185), Expect = 2e-14 Identities = 34/48 (70%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 S+KL R+NK+ T++SRE+QT+V+L+LPGELA+HA+SEGTKAVTKF+SS Sbjct: 72 SSKLVRFNKRRTLSSREVQTAVKLLLPGELARHAISEGTKAVTKFSSS 119
>H2B1_STRPU (P06145) Histone H2B.1, sperm| Length = 139 Score = 75.9 bits (185), Expect = 2e-14 Identities = 34/48 (70%), Positives = 46/48 (95%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++L +YN++ T++SREIQT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 91 ASRLTKYNRRSTVSSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 138
>H2B1_PARAN (P02290) Histone H2B.1, sperm| Length = 144 Score = 73.9 bits (180), Expect = 9e-14 Identities = 33/48 (68%), Positives = 44/48 (91%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 + +L YN++ T++SRE+QT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 96 AGRLTTYNRRSTVSSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 143
>H2B2_STRPU (P16887) Histone H2B.2, sperm| Length = 143 Score = 73.9 bits (180), Expect = 9e-14 Identities = 35/48 (72%), Positives = 45/48 (93%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++L R N++ TI+SREIQT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 95 ASRLTRANRRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 142
>H2B2_LYTPI (P06146) Histone H2B.2, sperm| Length = 142 Score = 72.0 bits (175), Expect = 4e-13 Identities = 34/48 (70%), Positives = 45/48 (93%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++L + N++ TI+SREIQT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 94 ASRLCQANRRRTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 141
>H2B2_PARAN (P02291) Histone H2B.2, sperm| Length = 143 Score = 71.2 bits (173), Expect = 6e-13 Identities = 33/48 (68%), Positives = 44/48 (91%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++L N++ T++SREIQT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 95 ASRLTSANRRSTVSSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 142
>H2B3_PARAN (P02292) Histone H2B.3, sperm| Length = 148 Score = 71.2 bits (173), Expect = 6e-13 Identities = 33/48 (68%), Positives = 44/48 (91%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 174 +++L N++ T++SREIQT+VRL+LPGELAKHAVSEGTKAVTK+T+S Sbjct: 100 ASRLTSANRRSTVSSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTTS 147
>H2B_PENVA (P83863) Histone H2B (Fragments)| Length = 53 Score = 68.6 bits (166), Expect = 4e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 296 NKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKF 183 NK+ TITSREIQT+VRL+LPGELAKHAVSEGTKAVTK+ Sbjct: 16 NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY 53
>H2B_TRYCR (P27795) Histone H2B| Length = 112 Score = 58.9 bits (141), Expect = 3e-09 Identities = 28/47 (59%), Positives = 39/47 (82%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTS 177 +A + R NKK T+ +RE+QT+VRLVLP +LAKHA++EGTKAV+ +S Sbjct: 66 AATVVRVNKKRTLGARELQTAVRLVLPADLAKHAMAEGTKAVSHASS 112
>H2B_LEIEN (P27893) Histone H2B| Length = 111 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVT 189 +A + R +KK T+ +RE+QT+VRLVLP ELAKHA++EGTKAV+ Sbjct: 65 AASIVRAHKKLTLGAREVQTAVRLVLPPELAKHAMAEGTKAVS 107
>H2B_ENTIV (P40284) Histone H2B| Length = 134 Score = 47.0 bits (110), Expect = 1e-05 Identities = 21/44 (47%), Positives = 33/44 (75%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTK 186 ++ L R +K T+T++EI+T+ +L+L G+L KHAVSEG AV + Sbjct: 79 ASSLTRNYQKSTLTTKEIETATKLILKGDLNKHAVSEGQSAVKR 122
>H2B_ENCCU (Q8SRE2) Histone H2B| Length = 130 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/44 (36%), Positives = 27/44 (61%) Frame = -3 Query: 317 SAKLARYNKKPTITSREIQTSVRLVLPGELAKHAVSEGTKAVTK 186 + +LAR K T+ S +I ++ ++L GEL K A+ E A++K Sbjct: 79 AGELARKVGKQTVGSDDIISAFEILLKGELRKLAIREVHNALSK 122
>CEF1_CRYNE (Q5K9L1) Pre-mRNA-splicing factor CEF1| Length = 838 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 287 PTITSREIQTSVRLVLPGELAKHAVSEGTKA 195 P + RE++ V++ GELA+ V +G KA Sbjct: 314 PQVGERELEDIVKIGQAGELARELVGDGNKA 344
>PUB1_SCHPO (Q92462) E3 ubiquitin--protein ligase pub1 (EC 6.3.2.-)| Length = 767 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 132 ILYVVSATMLHPL*GLCRLRV*RN 61 ++Y +S LHPL G C ++V RN Sbjct: 397 LIYFLSQPALHPLPGQCHIKVRRN 420
>PGLR2_JUNAS (Q9FY19) Polygalacturonase precursor (PG) (EC 3.2.1.15) (Pectinase)| (Major pollen allergen Jun a 2) Length = 507 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 152 MDELMVAFCM*LAPRCYTLCKDCAACGSEEIVMLPSE 42 MDE M A P C CK C C + I++ P++ Sbjct: 451 MDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQ 487
>NOC4L_MOUSE (Q8BHY2) Nucleolar complex protein 4 homolog (NOC4 protein homolog)| (NOC4-like protein) (Nucleolar complex-associated protein 4-like protein) Length = 516 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 175 EEVNLVTALVPSETACLASSPGRTRRTEVWI 267 E L +PSE LA S G T + +VWI Sbjct: 62 EREELFVGSLPSEDTALAGSQGATYKYKVWI 92
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 187 LVTALVPSETACLASSPGRTRRTEVWIS 270 ++T TA +SSPGR R VWIS Sbjct: 2051 VLTTTTTGFTATPSSSPGRARTLPVWIS 2078 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,255,863 Number of Sequences: 219361 Number of extensions: 448358 Number of successful extensions: 1268 Number of sequences better than 10.0: 113 Number of HSP's better than 10.0 without gapping: 1243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1266 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)