| Clone Name | rbaet123a12 |
|---|---|
| Clone Library Name | barley_pub |
>CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Protein Xantha-l) Length = 417 Score = 71.2 bits (173), Expect = 6e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 337 PLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 PLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY Sbjct: 383 PLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 417
>CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 68.2 bits (165), Expect = 5e-12 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 337 PLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 PLIA LVSEI+AAYLMPPIESGSVDFAEFEPKLVY Sbjct: 371 PLIAALVSEILAAYLMPPIESGSVDFAEFEPKLVY 405
>CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 62.8 bits (151), Expect = 2e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 337 PLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 PLIA L SE++A YLMPPIESGSVDFAEFEP+LVY Sbjct: 371 PLIAALASELLATYLMPPIESGSVDFAEFEPQLVY 405
>CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Copper response defect 1 protein) (Dicarboxylate diiron protein) (AtZIP Length = 409 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -2 Query: 337 PLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 PL+ L SEI+AAYLMPP+ESGSVDFAEFEP LVY Sbjct: 375 PLVTSLASEILAAYLMPPVESGSVDFAEFEPNLVY 409
>CTH1_CHLRE (Q9AR22) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) (Copper target homolog 1 protein) Length = 407 Score = 31.6 bits (70), Expect = 0.51 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -2 Query: 337 PLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 233 P++ ++V+E+ ++M P ESGS D + LVY Sbjct: 373 PILERMVAEVFQVFIMTPKESGSYDLDANKTALVY 407
>LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1268 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -1 Query: 227 LSKKDSSLPIFTNIMMHHAPRESLNEHRVHG*LT*STSSCAHL 99 +S + + P N+ +HH P S+ HR+ G +S HL Sbjct: 214 ISAEVQAPPPVVNVRVHHPPEASVQVHRIEGPNAEGPASSQHL 256
>GRIPE_HUMAN (Q6GYQ0) GTPase-activating Rap/Ran-GAP domain-like 1| (GAP-related-interacting partner to E12) (GRIPE) (Tuberin-like protein 1) Length = 2036 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 190 FVKIGRDESFFDKFSRQAWAQIRQNQRSQTRLGA*GTQR 306 F K+ D+SF +SR Q QRS T G+ GT++ Sbjct: 707 FQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEK 745
>GRIPE_MOUSE (Q6GYP7) GTPase-activating RapGAP domain-like 1| (GAP-related-interacting partner to E12) (GRIPE) (Tuberin-like protein 1) Length = 2035 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 190 FVKIGRDESFFDKFSRQAWAQIRQNQRSQTRLGA*GTQR 306 F K+ D+SF +SR Q QRS T G+ GT++ Sbjct: 706 FQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEK 744 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,360,483 Number of Sequences: 219361 Number of extensions: 806333 Number of successful extensions: 1462 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1462 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)