| Clone Name | rbaet122f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DUFFY_MOUSE (Q9QUI6) Duffy antigen/chemokine receptor (CD234 ant... | 32 | 0.95 | 2 | NAPG_HAEIN (P44652) Ferredoxin-type protein napG homolog | 30 | 2.1 | 3 | MURD_SYNEL (Q8DMN8) UDP-N-acetylmuramoylalanine--D-glutamate lig... | 30 | 2.1 | 4 | KLKB1_MOUSE (P26262) Plasma kallikrein precursor (EC 3.4.21.34) ... | 30 | 2.8 |
|---|
>DUFFY_MOUSE (Q9QUI6) Duffy antigen/chemokine receptor (CD234 antigen)| Length = 334 Score = 31.6 bits (70), Expect = 0.95 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -2 Query: 189 SIYRGCLMSLGIWPWQGATYQRALAMTTLCGCFFCPDPR 73 S + L +LG W W Y A A L GC+ C +PR Sbjct: 120 SAHSTALCNLGYWVW----YTSAFAQALLIGCYACLNPR 154
>NAPG_HAEIN (P44652) Ferredoxin-type protein napG homolog| Length = 279 Score = 30.4 bits (67), Expect = 2.1 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 Query: 123 PFDMLHLAKARSPGTSGNPYRCCR 194 P+DMLHLA SP +G PY R Sbjct: 83 PYDMLHLASLLSPVEAGTPYFIAR 106
>MURD_SYNEL (Q8DMN8) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 454 Score = 30.4 bits (67), Expect = 2.1 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 436 NLVPELWDISTSGFNSIASSICRCVPVVEA*LWFFDPPL 320 N P+ W IST G ++ I + + + E +WF D PL Sbjct: 231 NRWPQAWWISTQGAIALPKGIAQGIYIAEDQVWFQDQPL 269
>KLKB1_MOUSE (P26262) Plasma kallikrein precursor (EC 3.4.21.34) (Plasma| prekallikrein) (Kininogenin) (Fletcher factor) [Contains: Plasma kallikrein heavy chain; Plasma kallikrein light chain] Length = 638 Score = 30.0 bits (66), Expect = 2.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 186 IYRGCLMSLGIWPWQGATYQRALAMTTLCG 97 I G SLG WPWQ + + ++ T LCG Sbjct: 391 IVGGTNASLGEWPWQVSLQVKLVSQTHLCG 420 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,236,745 Number of Sequences: 219361 Number of extensions: 1166373 Number of successful extensions: 3243 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3242 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)