| Clone Name | rbaet11g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TENS1_HUMAN (Q9HBL0) Tensin-1 | 32 | 0.48 | 2 | AROB_NITMU (Q2YB61) 3-dehydroquinate synthase (EC 4.2.3.4) | 31 | 0.63 | 3 | TENS1_BOVIN (Q9GLM4) Tensin-1 | 30 | 1.1 | 4 | GR39B_DROME (P58960) Putative gustatory receptor 39b | 28 | 4.1 | 5 | CLCC_ARATH (Q96282) Chloride channel protein CLC-c (AtCLC-c) | 27 | 9.1 |
|---|
>TENS1_HUMAN (Q9HBL0) Tensin-1| Length = 1735 Score = 31.6 bits (70), Expect = 0.48 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -2 Query: 138 TRSPASGRLSAFSQSTQSESVPKEPPKGLP 49 ++SPAS L AF +T S P++PP LP Sbjct: 811 SKSPASSSLPAFLPTTHSPPGPQQPPASLP 840
>AROB_NITMU (Q2YB61) 3-dehydroquinate synthase (EC 4.2.3.4)| Length = 366 Score = 31.2 bits (69), Expect = 0.63 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 168 SILTSDISRSCHQKPSPIDRTSRY*HLKKLLSRSRRFGESLE 293 SILT I RSC K ++ R ++ LL+ FG ++E Sbjct: 217 SILTDAIKRSCQHKAEVVEEDERESGMRALLNLGHTFGHAIE 258
>TENS1_BOVIN (Q9GLM4) Tensin-1| Length = 1715 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 135 RSPASGRLSAFSQSTQSESVPKEPPKGLP 49 +SPA+ S+F +TQS P++PP LP Sbjct: 815 KSPATSSSSSFLPTTQSSVGPQQPPASLP 843
>GR39B_DROME (P58960) Putative gustatory receptor 39b| Length = 369 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = -2 Query: 369 LGSSHPLKKA**LTGLAPWHRKCLRAQVIHRSDETLKAAFSSVSSGT---FCQSGKVF 205 L S HP K L GL PW C +++ + + + ++V G F QS ++F Sbjct: 2 LYSFHPYLKYFALLGLVPWSESCAQSKFVQKVYSAILIILNAVHFGISIYFPQSAELF 59
>CLCC_ARATH (Q96282) Chloride channel protein CLC-c (AtCLC-c)| Length = 779 Score = 27.3 bits (59), Expect = 9.1 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = -1 Query: 298 QGSSDSPKRRDLESSFFK-CQ*RDV--LSIGEGFW*QDLEISEVRMLT*VTRNPVKNT 134 QG S +R S + C+ RD +G+G +DL++SE M V +P+ NT Sbjct: 659 QGKKFSKQRTTFGSQILRSCKARDFGKAGLGKGLKIEDLDLSEEEMEMYVDLHPITNT 716 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,852,538 Number of Sequences: 219361 Number of extensions: 983622 Number of successful extensions: 2492 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2491 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)