| Clone Name | rbaet11f08 |
|---|---|
| Clone Library Name | barley_pub |
>METE_AQUAE (O67606) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 761 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 324 ALSLLDIFEDKDDA**RLLSADQGTVEEGTACNKMDW 214 AL+LLD +D ++A +++ D+ EG K DW Sbjct: 581 ALALLDEVKDLENAGIKVIQIDEPAFREGAPLKKRDW 617
>VAL1_BCTV (P14991) AL1 protein (40.8 kDa protein)| Length = 358 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 38 P*QYISYVHEGSSSAAITTHYRQRGAHNFIAHKMENPIKLTY 163 P +Y S + EG S T R GAHN+I ++ ++ Y Sbjct: 212 PLRYNSIIVEGDSRTGKTMWARSLGAHNYITGHLDFSLRTYY 253
>FZO_DROSI (Q9N6P4) Transmembrane GTPase fzo (EC 3.6.5.-) (Protein fuzzy| onions) (Fragment) Length = 454 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 44 QYISYVHEGSSSAAITTHYRQRGAHNFIAHKMENPIKLTYISPLID 181 +++ + ++ S+ A++ + G H A K+ N +K T ISP I+ Sbjct: 69 EFLRFENDFSNCLAVSALKTKFGPHLLSAQKILNQLKSTLISPFIE 114
>RSBW_BACHK (Q6HMH0) Serine-protein kinase rsbW (EC 2.7.11.1) (Anti-sigma-B| factor) (Sigma-B negative effector rsbW) Length = 160 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 293 RMMHDEGCSVLIRGLLRKEQRAIRWTGVYIHTYDLY 186 ++MHDEG +VL+ +++EQ + G I TY+ Y Sbjct: 127 QIMHDEGMTVLMTKYIQREQ--VENDGNPISTYESY 160
>RSBW_BACCZ (Q63F14) Serine-protein kinase rsbW (EC 2.7.11.1) (Anti-sigma-B| factor) (Sigma-B negative effector rsbW) Length = 160 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 293 RMMHDEGCSVLIRGLLRKEQRAIRWTGVYIHTYDLY 186 ++MHDEG +VL+ +++EQ + G I TY+ Y Sbjct: 127 QIMHDEGMTVLMTKYIQREQ--VENDGNPISTYESY 160
>RSBW_BACCR (Q81H23) Serine-protein kinase rsbW (EC 2.7.11.1) (Anti-sigma-B| factor) (Sigma-B negative effector rsbW) Length = 160 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 293 RMMHDEGCSVLIRGLLRKEQRAIRWTGVYIHTYDLY 186 ++MHDEG +VL+ +++EQ + G I TY+ Y Sbjct: 127 QIMHDEGMTVLMTKYIQREQ--VENDGNPISTYESY 160
>RSBW_BACAN (Q9K5J7) Serine-protein kinase rsbW (EC 2.7.11.1) (Anti-sigma-B| factor) (Sigma-B negative effector rsbW) Length = 160 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 293 RMMHDEGCSVLIRGLLRKEQRAIRWTGVYIHTYDLY 186 ++MHDEG +VL+ +++EQ + G I TY+ Y Sbjct: 127 QIMHDEGMTVLMTKYIQREQ--VENDGNPISTYESY 160
>CCMA_BORBR (Q7WIP8) Cytochrome c biogenesis ATP-binding export protein ccmA| (EC 3.6.3.41) (Heme exporter protein A) Length = 224 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 260 IRGLLRKEQRAIRWTGVYIHTYDLYHYQLMVIY 162 + GLLR + +RW G IH DL Y L + Y Sbjct: 53 LAGLLRPRRGEVRWNGADIHA-DLPGYYLHMAY 84
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -2 Query: 332 SPRLSPSLIYLKTRMMHDEGCSVLIRGLLR 243 SP+LS SL L +M + GCSV+ G L+ Sbjct: 657 SPKLSNSLSMLFNKMYLNGGCSVVPTGFLK 686 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,676,533 Number of Sequences: 219361 Number of extensions: 860594 Number of successful extensions: 1619 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1619 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)