| Clone Name | rbaet119f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KSR1_MOUSE (Q61097) Kinase suppressor of ras-1 (Kinase suppresso... | 30 | 3.7 | 2 | RCNA_ECOL6 (Q8FFX9) Nickel/cobalt efflux system rcnA | 29 | 6.3 | 3 | CY561_PIG (Q95245) Cytochrome b561 (Cytochrome b-561) | 29 | 6.3 |
|---|
>KSR1_MOUSE (Q61097) Kinase suppressor of ras-1 (Kinase suppressor of ras)| (mKSR1) (Hb protein) Length = 873 Score = 29.6 bits (65), Expect = 3.7 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = -2 Query: 186 FIIPYHVFQYLQNEFGITVMTVTGQWVSVFFLTQVCNICVILCSKKLLCMNHARIKC 16 F +P+ Q ++ + G++V T ++ + +L+QVCN+C + C H R+KC Sbjct: 314 FELPHGSPQLVRRDIGLSV---THRFSTKSWLSQVCNVCQKSMIFGVKC-KHCRLKC 366
>RCNA_ECOL6 (Q8FFX9) Nickel/cobalt efflux system rcnA| Length = 274 Score = 28.9 bits (63), Expect = 6.3 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +2 Query: 119 VTVITVIPNSFCKYWKTW*GMIKGQTNRACGDHK*QRHSA*NHGD 253 ++ + +I +F +W+TW G N DH+ H +H D Sbjct: 93 ISAVIIISTAFWMFWRTWRGERNWLENMHEHDHEHHHHDHEDHHD 137
>CY561_PIG (Q95245) Cytochrome b561 (Cytochrome b-561)| Length = 252 Score = 28.9 bits (63), Expect = 6.3 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 213 SPHARLVWPFIIPYHV-FQYLQNEFGITVMTVTGQWVSVF 97 SP R P +PY+V F L G+TV+ VTG W+ + Sbjct: 3 SPAGRTPAPGALPYYVAFSQL---LGLTVVAVTGAWLGAY 39 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,543,647 Number of Sequences: 219361 Number of extensions: 793471 Number of successful extensions: 2565 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2565 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)