ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet119f01 |
|---|---|
| Clone Library Name | barley_pub |
>GGPP2_ARATH (O04046) Geranylgeranyl pyrophosphate synthetase 2 precursor (GGPP| synthetase 2) (GGPS2) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10); Farnesyltranstransferase (EC 2.5.1.29)] Length = 376 Score = 29.6 bits (65), Expect = 1.8 Identities = 23/91 (25%), Positives = 38/91 (41%), Gaps = 10/91 (10%) Frame = +3 Query: 129 INQSIDHQDQDERKKERKRGENVREKQFT----------SQNLTKHFLVAATVGEGRVL* 278 ++ I ++ E ++E + G V FT ++++ K A VGE Sbjct: 54 LDSPIVEDEEGEEREEEEEGGIVSNANFTFEFDPYMMSKAESVNKALEEAIPVGEP---- 109 Query: 279 AHVYERYNLDLLLAGRRPAVRWCRAGCRLVG 371 ++E +L AG+R C A C LVG Sbjct: 110 LKIHEAMRYAILAAGKRVRPILCLASCELVG 140
>EAT5_CAEEL (Q27295) Innexin eat-5| Length = 423 Score = 29.3 bits (64), Expect = 2.3 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = +3 Query: 21 YLYI*SIVGVIYDVYPSIDILLCSSYALLHAKLYRSINQSIDHQDQDERKKERKRGENVR 200 +LYI ++ ++ SI LC + H KL + Q +D+QDQDE +++ V Sbjct: 280 FLYIWFLLVFFVTLFDSI--FLCYNMFSSH-KLVEFLQQFLDNQDQDENDEKKPEERKVY 336 Query: 201 EKQ 209 K+ Sbjct: 337 RKE 339
>EFTU_STRP6 (Q5XD49) Elongation factor Tu (EF-Tu)| Length = 398 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/66 (25%), Positives = 29/66 (43%) Frame = +3 Query: 42 VGVIYDVYPSIDILLCSSYALLHAKLYRSINQSIDHQDQDERKKERKRGENVREKQFTSQ 221 +G I V L + +L +L S+NQ D+ D +ER+RG + + Sbjct: 15 IGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEERERGITINTAHVEYE 74 Query: 222 NLTKHF 239 T+H+ Sbjct: 75 TATRHY 80
>EFTU_STRP3 (Q8K872) Elongation factor Tu (EF-Tu)| Length = 398 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/66 (25%), Positives = 29/66 (43%) Frame = +3 Query: 42 VGVIYDVYPSIDILLCSSYALLHAKLYRSINQSIDHQDQDERKKERKRGENVREKQFTSQ 221 +G I V L + +L +L S+NQ D+ D +ER+RG + + Sbjct: 15 IGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEERERGITINTAHVEYE 74 Query: 222 NLTKHF 239 T+H+ Sbjct: 75 TATRHY 80
>EFTU_STRP1 (P69952) Elongation factor Tu (EF-Tu)| Length = 398 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/66 (25%), Positives = 29/66 (43%) Frame = +3 Query: 42 VGVIYDVYPSIDILLCSSYALLHAKLYRSINQSIDHQDQDERKKERKRGENVREKQFTSQ 221 +G I V L + +L +L S+NQ D+ D +ER+RG + + Sbjct: 15 IGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEERERGITINTAHVEYE 74 Query: 222 NLTKHF 239 T+H+ Sbjct: 75 TATRHY 80
>OPGH_DICD3 (Q9F495) Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)| Length = 850 Score = 28.9 bits (63), Expect = 3.0 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 405 SSASTGA*IELVRPIDSPRDTNVRPAGGRPARDPDCNVRI 286 +SA A RPI+ R+ V A R +D DCN+R+ Sbjct: 769 TSAMATARHRFSRPIEDMREQRVNDALSRKPQDVDCNLRL 808
>TCMP_STRGA (P39887) Tetracenomycin polyketide synthesis O-methyltransferase| tcmP (EC 2.1.1.-) Length = 270 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 315 LAGRRPAVRWCRAGCRLVGRVQFKHQLM 398 LA RP +W AG R + +++F H+L+ Sbjct: 239 LADARPVEKWVGAGMRSIPQLRFAHRLL 266
>EFTU_STRP8 (Q8P1W4) Elongation factor Tu (EF-Tu)| Length = 398 Score = 28.5 bits (62), Expect = 4.0 Identities = 17/66 (25%), Positives = 29/66 (43%) Frame = +3 Query: 42 VGVIYDVYPSIDILLCSSYALLHAKLYRSINQSIDHQDQDERKKERKRGENVREKQFTSQ 221 +G I V L + +L +L S+NQ D+ D +ER+RG + + Sbjct: 15 IGTIGHVDHGKTTLTAAITTVLARRLPTSVNQPKDYASIDAAPEERERGITINTAHVEYE 74 Query: 222 NLTKHF 239 T+H+ Sbjct: 75 TETRHY 80
>GLE1_BRARE (Q6DRB1) Nucleoporin GLE1 (GLE1-like protein)| Length = 695 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/52 (26%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +3 Query: 57 DVYPSIDILLCSSYALLHAK-LYRSINQSIDHQDQDERKKERKRGENVREKQ 209 D +PS++ L + AL + L RS+ +++ + ++KKE++ E R ++ Sbjct: 321 DQFPSVEDLSVAERALQEMRSLVRSLQEAVSQAAERKKKKEQEEEEEKRRQE 372
>YCX1_SOYBN (P09363) Hypothetical 16.8 kDa protein (ORF 143)| Length = 143 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 133 LIDLYNFACKSAYDEHRRISMEGYTSYIT-PTIDY 32 +ID Y K+ +DE R +EG SY++ T+ Y Sbjct: 103 IIDTYRILWKAVFDESRMYGLEGDLSYLSRSTLQY 137
>ZO2_CANFA (Q95168) Tight junction protein ZO-2 (Zonula occludens 2 protein)| (Zona occludens 2 protein) (Tight junction protein 2) Length = 1174 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 123 RSINQSIDHQDQDERKKERKRGENV 197 RS+ + +DH D R +ER RG ++ Sbjct: 172 RSLERGLDHDDDYRRPRERSRGRSL 196
>PRL1_OREMO (P09319) Prolactin-1 precursor (Prolactin I) (PRL-188)| Length = 212 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 323 PPAGRTLVSRGLSIGRTSSIQAPVDADE 406 PP GR ++ R ++ TSS+Q P+D D+ Sbjct: 57 PPIGRVIMPRP-AMCHTSSLQTPIDKDQ 83
>ALP14_SCHPO (O94534) Spindle pole body component alp14 (Altered polarity| protein 14) Length = 809 Score = 27.3 bits (59), Expect = 8.9 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +2 Query: 299 QSGSLAGRPPAGRTLVSRGLSIGRTSSIQAPVDADEP 409 ++G L RP VSRGLS G +SS+Q V A P Sbjct: 568 ENGPLLPRPTTRP--VSRGLSRGTSSSLQQKVKASTP 602 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,466,018 Number of Sequences: 219361 Number of extensions: 859889 Number of successful extensions: 2857 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2853 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
