ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet119d12 |
|---|---|
| Clone Library Name | barley_pub |
>TT8_ARATH (Q9FT81) TRANSPARENT TESTA 8 protein (Basic helix-loop-helix| protein 42) (bHLH42) (AtbHLH042) Length = 518 Score = 31.6 bits (70), Expect = 0.52 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 127 SHISV*ELRKETYNLSIAISRHHLNLVIELEIARVVGDTVAYLHHL 264 SH+ R+E N R + V +++ ++GDT+AY++HL Sbjct: 363 SHVVAERRRREKLNEKFITLRSMVPFVTKMDKVSILGDTIAYVNHL 408
>CCL27_MOUSE (Q9Z1X0) Small inducible cytokine A27 precursor (CCL27) (CC| chemokine ILC) (IL-11 R-alpha-locus chemokine) (mILC) (ALP) (Skinkine) (ESkine) (Cutaneous T-cell attracting chemokine) (CTACK) Length = 120 Score = 30.8 bits (68), Expect = 0.89 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = +2 Query: 179 PSADTILILSSSSKSPEL*VTPLPTSTTCCTIG*SRPSPWQIL 307 P++ L+L S +PE PLP+ST+CCT +P P ++L Sbjct: 7 PASSLPLLLLLLSPAPEA-ALPLPSSTSCCTQLYRQPLPSRLL 48
>ATG18_CRYNE (Q5KGQ2) Autophagy-related protein 18| Length = 423 Score = 29.3 bits (64), Expect = 2.6 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 5/81 (6%) Frame = +2 Query: 68 LVPMCISIINLNRKMKL----SYVHIYRYRSSERRHTIYQLPSADTILILSSSSKSPEL* 235 + P + + +NRK + + ++IY + + HTI P+ + + LSSSS+ L Sbjct: 95 IFPTSVLAVKMNRKRLIVVLENEIYIYDISTMKLLHTIETGPNPNAVCALSSSSERSYLA 154 Query: 236 V-TPLPTSTTCCTIG*SRPSP 295 +P+P++++ + P+P Sbjct: 155 YPSPVPSASSTPLSSSAIPAP 175
>EMAL1_HUMAN (O00423) Echinoderm microtubule-associated protein-like 1 (EMAP-1)| (HuEMAP-1) Length = 717 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = +2 Query: 104 RKMKLSYVHIYRYRSSERRHTIYQLPSADTILILSS 211 +++KL +V Y YR + R+ +Y LP+ +T+ ++S Sbjct: 121 KRLKLEWV--YGYRGRDCRNNLYLLPTGETVYFIAS 154
>TFR1_CHICK (Q90997) Transferrin receptor protein 1 (TfR1) (TR) (TfR) (Trfr)| Length = 776 Score = 28.9 bits (63), Expect = 3.4 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -3 Query: 318 GHPPKICQGLGRDYPIVQQVVEVGNG--VTYNSGDFELDDKIKMVSADGN**IVCLLSEL 145 G P + GL +D+ I+Q+VV NG V +G L +K+ G ++ + L Sbjct: 237 GKPVYVNYGLKKDFEIIQKVVASLNGTIVIVRAGKITLAEKVANAKEAGAAGVLMYVDSL 296 Query: 144 LY 139 +Y Sbjct: 297 MY 298
>MB21_ARATH (O80998) Myrosinase-binding protein-like At2g25980| Length = 449 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 252 PPPPVVRLGSHGPALGKSWEDG 317 PPPP +L G G+SW+DG Sbjct: 299 PPPPTEKLQGSGGDGGESWDDG 320
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 322 QGPSSQDLPRAGP*LPNRTTGGGGRQRCHLQLW 224 Q PSS+ + AG +TT G R RC +Q+W Sbjct: 40 QFPSSKTMSNAGAEWEQKTTSNGSRVRC-MQVW 71
>YPT3_CAEEL (P41881) Hypothetical protein F37A4.3| Length = 229 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 178 QLINCMSPFGAPIPIYVNIGQFHLSVQVNY 89 +LI +S F + +PIY + FH V NY Sbjct: 122 RLIKELSKFDSHLPIYTILRDFHADVNFNY 151
>CSD_TREPA (O83623) Probable cysteine desulfurase (EC 2.8.1.7)| Length = 404 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 175 IAISRHHLNLVIELEIARVVGDTVAYLH 258 +AIS HH N+V + R G T+ +L+ Sbjct: 113 LAISNHHANIVPWQHVCRCTGATIQWLY 140
>EMAL_CAEEL (O45487) Echinoderm microtubule-associated protein-like elp-1| Length = 891 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 110 MKLSYVHIYRYRSSERRHTIYQLPSADTI 196 MK++ H+Y YR + R I LP+ + + Sbjct: 278 MKVTLKHVYSYRGKDVRSNIEMLPTGELV 306
>SAM68_HUMAN (Q07666) KH domain-containing, RNA-binding, signal| transduction-associated protein 1 (p21 Ras GTPase-activating protein-associated p62) (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p68) Length = 443 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 316 PSSQDLPRAGP*LPNRTTGGGGRQR 242 PS + P P LP+R+ GGGG R Sbjct: 28 PSVRQTPSRQPPLPHRSRGGGGGSR 52
>AMPA_CAMJE (Q9PP04) Probable cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) Length = 483 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 315 HPPKICQGLGRDYPIVQQVVEVGNGVTYNSGDFEL 211 HPP++ + ++VV VG G+TY+SG L Sbjct: 221 HPPRLIHLSYKAKNAKKRVVFVGKGLTYDSGGLSL 255
>ACT1_TETTH (P10992) Actin, macronuclear| Length = 375 Score = 27.3 bits (59), Expect = 9.8 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 6/52 (11%) Frame = +2 Query: 107 KMKLSYVHI------YRYRSSERRHTIYQLPSADTILILSSSSKSPEL*VTP 244 K KL YV I Y+ S + Y+LP +TI + + PEL P Sbjct: 213 KEKLCYVAIDYEAELKAYKESSQNDKSYELPDGNTITVQDQRFRCPELLFKP 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,089,196 Number of Sequences: 219361 Number of extensions: 1057453 Number of successful extensions: 2534 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2532 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
