| Clone Name | rbaet119d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | QUEF_AZOSE (Q5P6G9) 7-cyano-7-deazaguanine reductase (EC 1.7.1.-) | 29 | 3.1 | 2 | SNG2_MOUSE (O55101) Synaptogyrin-2 (Cellugyrin) | 28 | 4.1 | 3 | SNG2_RAT (O54980) Synaptogyrin-2 (Cellugyrin) | 28 | 5.3 | 4 | BEM2_YEAST (P39960) GTPase-activating protein BEM2/IPL2 (Bud eme... | 27 | 9.0 |
|---|
>QUEF_AZOSE (Q5P6G9) 7-cyano-7-deazaguanine reductase (EC 1.7.1.-)| Length = 283 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 161 SITHELGDEISPMGRSVVDRTQWCP 235 S TH+ G E SP+G+SVV R + P Sbjct: 4 SDTHDHGAEASPLGQSVVYRDSYAP 28
>SNG2_MOUSE (O55101) Synaptogyrin-2 (Cellugyrin)| Length = 224 Score = 28.5 bits (62), Expect = 4.1 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = -3 Query: 147 DQFACCARVCQAEC--GGVVGVLLYQDFVTSVCFLVEDVFMNQISESS 10 DQ C + C G +GVL F+ S FLV D F +QIS ++ Sbjct: 55 DQLYCVFNQNEDACRYGSAIGVLA---FLASAFFLVVDAFFSQISNAT 99
>SNG2_RAT (O54980) Synaptogyrin-2 (Cellugyrin)| Length = 224 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = -3 Query: 147 DQFACCARVCQAEC--GGVVGVLLYQDFVTSVCFLVEDVFMNQISESS 10 DQ C + C G +GVL F+ S FLV D F +QIS ++ Sbjct: 55 DQLHCVFNRNEDACRYGSAIGVLA---FLASAFFLVVDAFFSQISNAT 99
>BEM2_YEAST (P39960) GTPase-activating protein BEM2/IPL2 (Bud emergence protein| 2) Length = 2167 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 9/46 (19%) Frame = +1 Query: 40 IFYEKTHRSYKILIKQHTNHTP---------TLSLTHTRTACKLII 150 +F+EK +S K+LIK HT+ T S + T CK+I+ Sbjct: 1465 LFFEKLPQSIKLLIKLHTSLTTFFVMEISNVNKSSSERLTTCKVIL 1510 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,769,950 Number of Sequences: 219361 Number of extensions: 509704 Number of successful extensions: 1236 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1236 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)