| Clone Name | rbaet119c09 |
|---|---|
| Clone Library Name | barley_pub |
>DNBI_EBV (P03227) Major DNA-binding protein| Length = 1128 Score = 30.8 bits (68), Expect = 1.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +2 Query: 191 SFTNAVTPNPNICVNGPYLMYRHSGHKIMQKRRLLEALSLIHLVQR 328 SF + T N +NGPY+ + ++ HK + L +L L H R Sbjct: 738 SFIKSTTRRENYIINGPYMKFLNTYHKTLFPDTKLSSLYLWHNFSR 783
>RECO_CHLPN (Q9Z7W5) DNA repair protein recO (Recombination protein O)| Length = 252 Score = 30.4 bits (67), Expect = 1.9 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 206 VTPNPNIC-VNGPYLMYRHSGHKIMQKRRLLEALSL 310 +TP ++C + PY YR+ GHK+ +K + +A+S+ Sbjct: 148 LTPACSLCKASLPYACYRYQGHKLCKKHQHKQAISI 183
>DNBI_SHV21 (P24910) Major DNA-binding protein| Length = 1128 Score = 30.0 bits (66), Expect = 2.4 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 194 FTNAVTPNPNICVNGPYLMYRHSGHKIMQKRRLLEALSLIH 316 F + T + V GPY+ + +S HK+M + AL L H Sbjct: 741 FIKSATKKDSYIVTGPYMKFLNSLHKVMFPNAKISALYLWH 781
>SEC16_SCHPO (O14029) Multidomain vesicle coat protein| Length = 1995 Score = 28.9 bits (63), Expect = 5.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 176 YSATRSFTNAVTPNPNICVNGPY 244 Y T+S N ++P P++ VN PY Sbjct: 723 YEMTKSHINVISPGPSLQVNAPY 745
>Y527_MYCPN (P75251) Hypothetical protein MG350.1 homolog (G12_orf225)| Length = 225 Score = 28.5 bits (62), Expect = 7.1 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +1 Query: 1 SFYTYSKLHFIFTKDFXXXXXXXXXXXSFILHFLLYPMLSCIK 129 +F+ + H +F F SF+ HF+ P LS +K Sbjct: 7 AFWPKKEQHQLFNLSFSAMMLALALIASFVSHFISIPFLSALK 49
>ATM_PIG (Q6PQD5) Serine-protein kinase ATM (EC 2.7.11.1) (Ataxia| telangiectasia mutated homolog) (A-T, mutated homolog) Length = 3056 Score = 28.5 bits (62), Expect = 7.1 Identities = 19/72 (26%), Positives = 29/72 (40%), Gaps = 10/72 (13%) Frame = +2 Query: 104 YTPCSPVSNGNYKATPPMLLQACYYSATRSFTNAVTPN---------PNICVN-GPYLMY 253 YT YK P L+ C++ +S N + + P I VN PY Y Sbjct: 1241 YTNIEDFYRSCYKVLIPHLVMRCHFDEVKSIANQIQGDWKSLLTDCFPKILVNILPYFAY 1300 Query: 254 RHSGHKIMQKRR 289 +G + M ++R Sbjct: 1301 EDTGDRGMAQQR 1312
>SKI_AVIES (P17863) Transforming protein Ski| Length = 437 Score = 28.1 bits (61), Expect = 9.2 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +2 Query: 95 ISCYTPCSPVSNGNYKATP---PMLLQACYYSATRSFTNAVTPN 217 +S + P SP + N K P L++ + + +SF NAV PN Sbjct: 373 LSAFRPWSPAVSANEKELSTHLPALIRDSSFYSYKSFENAVAPN 416
>SKI_CHICK (P49140) Ski oncogene (C-ski)| Length = 750 Score = 28.1 bits (61), Expect = 9.2 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +2 Query: 95 ISCYTPCSPVSNGNYKATP---PMLLQACYYSATRSFTNAVTPN 217 +S + P SP + N K P L++ + + +SF NAV PN Sbjct: 394 LSAFRPWSPAVSANEKELSTHLPALIRDSSFYSYKSFENAVAPN 437 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,255,638 Number of Sequences: 219361 Number of extensions: 1271052 Number of successful extensions: 3025 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3025 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)