| Clone Name | rbaet119c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exog... | 30 | 3.5 | 2 | COP1_PEA (P93471) Ubiquitin ligase protein COP1 (EC 6.3.2.-) (Co... | 28 | 7.7 |
|---|
>GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (1,4-beta-cellobiohydrolase) (Beta-glucancellobiohydrolase) Length = 525 Score = 29.6 bits (65), Expect = 3.5 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 323 TIDVMLTYDSRRRRRSTPSGATMCYFQNKW 234 T+ +T DS R SG+T CY NKW Sbjct: 45 TVQASITLDSNWRWTHQVSGSTNCYTGNKW 74
>COP1_PEA (P93471) Ubiquitin ligase protein COP1 (EC 6.3.2.-) (Constitutive| photomorphogenesis protein 1) Length = 672 Score = 28.5 bits (62), Expect = 7.7 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 6/62 (9%) Frame = +3 Query: 45 HVYIHERTTES---CAQMNAY---QHANDNYKVVIIIMGAWNKRN*KGMMEYKECKKDAS 206 H + E TT S C N Y Q A+ +Y+ ++ + W K +MEY+E +K A Sbjct: 408 HCPVVEMTTRSKLSCLSWNKYAKNQIASSDYEGIVTV---WTMTTRKSLMEYEEHEKRAW 464 Query: 207 SL 212 S+ Sbjct: 465 SV 466 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,106,405 Number of Sequences: 219361 Number of extensions: 894919 Number of successful extensions: 1765 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1765 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)