| Clone Name | rbaet119c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VASN_MOUSE (Q9CZT5) Vasorin precursor (Protein Slit-like 2) | 33 | 0.41 | 2 | MATK_CUPAN (Q646R8) Maturase K (Intron maturase) | 30 | 3.5 | 3 | SOMA_CAVPO (Q9JKM4) Somatotropin precursor (Growth hormone) | 29 | 5.9 | 4 | ESR2_ICTPU (Q9IAK1) Estrogen receptor beta (ER-beta) | 29 | 5.9 | 5 | ODO2_PSEPU (P31051) Dihydrolipoyllysine-residue succinyltransfer... | 28 | 7.7 |
|---|
>VASN_MOUSE (Q9CZT5) Vasorin precursor (Protein Slit-like 2)| Length = 673 Score = 32.7 bits (73), Expect = 0.41 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Frame = +2 Query: 92 GKIVDTHDHLLSKNKLKHEVAILVSLK-----LVIENLRIAMVKPRTRSGVIIFQEI 247 G++++ HD +S N+L+H +++ L+ + N RIA ++P +G+ QE+ Sbjct: 214 GRLLNLHDLDVSDNQLEHMPSVIQGLRGLTRLRLAGNTRIAQIRPEDLAGLTALQEL 270
>MATK_CUPAN (Q646R8) Maturase K (Intron maturase)| Length = 507 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -1 Query: 285 SDVELLHFFFHIIISWN-MITPER-VRGFTMAIRRF 184 S + LL FF H +WN +ITP++ + GF+ + RF Sbjct: 172 SSLHLLRFFLHEYFNWNSLITPKKSISGFSTSNPRF 207
>SOMA_CAVPO (Q9JKM4) Somatotropin precursor (Growth hormone)| Length = 216 Score = 28.9 bits (63), Expect = 5.9 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 303 QEAALQSDVELLHFFFHIIISW 238 +EA +SDVELLHF +I SW Sbjct: 90 EEAQQRSDVELLHFSLLLIQSW 111
>ESR2_ICTPU (Q9IAK1) Estrogen receptor beta (ER-beta)| Length = 575 Score = 28.9 bits (63), Expect = 5.9 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = -1 Query: 444 SHDSHCAPEQGYFCRPGKVYTEARVCSSFVQPTSHRDHRH 325 SH+ H P C P Y+E + +++V H RH Sbjct: 78 SHNPHAMPALPLHCPPALPYSEPHIHTAWVDTKPHTSGRH 117
>ODO2_PSEPU (P31051) Dihydrolipoyllysine-residue succinyltransferase component| of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) (E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) (Fragment) Length = 58 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 210 PELVRALSYSKR*LYGRKSEVILHQIATLLLDPSRFI 320 P + ALSY R + G+++ L I LL DPSR + Sbjct: 19 PMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLL 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,778,830 Number of Sequences: 219361 Number of extensions: 1329208 Number of successful extensions: 3336 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3333 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)