| Clone Name | rbaet119c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AOFH_MYCTU (P63533) Putative flavin-containing monoamine oxidase... | 28 | 7.6 | 2 | AOFH_MYCBO (P63534) Putative flavin-containing monoamine oxidase... | 28 | 7.6 |
|---|
>AOFH_MYCTU (P63533) Putative flavin-containing monoamine oxidase aofH (EC| 1.4.3.-) Length = 454 Score = 28.5 bits (62), Expect = 7.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 Query: 238 PDGHPSRYGHWPNEKVQLYNDCIHWCLPGPIDIWNDLF 125 P G ++YGHW E V IHW D W F Sbjct: 403 PPGSWTKYGHWLREPV----GPIHWASTETADEWTGYF 436
>AOFH_MYCBO (P63534) Putative flavin-containing monoamine oxidase aofH (EC| 1.4.3.-) Length = 454 Score = 28.5 bits (62), Expect = 7.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 Query: 238 PDGHPSRYGHWPNEKVQLYNDCIHWCLPGPIDIWNDLF 125 P G ++YGHW E V IHW D W F Sbjct: 403 PPGSWTKYGHWLREPV----GPIHWASTETADEWTGYF 436 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,417,355 Number of Sequences: 219361 Number of extensions: 515879 Number of successful extensions: 1267 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1267 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)