| Clone Name | rbaet119c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYG_TREPA (O83678) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine... | 30 | 1.8 | 2 | KRB2D_SHEEP (P08131) Keratin, high-sulfur matrix protein, B2D | 30 | 1.8 | 3 | KRB2A_SHEEP (P02438) Keratin, high-sulfur matrix protein, B2A | 29 | 5.3 | 4 | KIRR2_HUMAN (Q6UWL6) Kin of IRRE-like protein 2 precursor (Kin o... | 28 | 9.0 |
|---|
>SYG_TREPA (O83678) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 462 Score = 30.4 bits (67), Expect = 1.8 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -3 Query: 425 DVDRAVEDSFSKAFLCDAYLAEQVGRIRRFVIPSHREKPGTPFC 294 D+ RAV D + F CD A +G+ R +++ GTPFC Sbjct: 379 DLARAVRDELREDFACDFDAAGAIGKRYR-----RQDEVGTPFC 417
>KRB2D_SHEEP (P08131) Keratin, high-sulfur matrix protein, B2D| Length = 181 Score = 30.4 bits (67), Expect = 1.8 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +3 Query: 102 FPRSSRS*TLGNYWIRRHCLQWCMACMTALQASACMCVLIKAGVCSPSTLE 254 FP S T G+ + + C Q T++Q S C I+ C P++++ Sbjct: 10 FPTCSTGGTCGSNFCQPTCCQTSCCQPTSIQTSCCQPTSIQTSCCQPTSIQ 60
>KRB2A_SHEEP (P02438) Keratin, high-sulfur matrix protein, B2A| Length = 171 Score = 28.9 bits (63), Expect = 5.3 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +3 Query: 102 FPRSSRS*TLGNYWIRRHCLQWCMACMTALQASACMCVLIKAGVCSPSTLE 254 FP S T G+ + C Q T++Q S C + I+ C P++++ Sbjct: 10 FPICSTGGTCGSSPCQPTCCQTSCCQPTSIQTSCCQPISIQTSCCQPTSIQ 60
>KIRR2_HUMAN (Q6UWL6) Kin of IRRE-like protein 2 precursor (Kin of irregular| chiasm-like protein 2) (Nephrin-like protein 3) Length = 708 Score = 28.1 bits (61), Expect = 9.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 220 SRQVCAVLARWRSIKWVMDNDQL*GQKGVPGFS 318 +R CA+ A W ++W L GQ+ +PG+S Sbjct: 41 ARLPCALGAYWGLVQWTKSGLALGGQRDLPGWS 73 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,064,011 Number of Sequences: 219361 Number of extensions: 1324230 Number of successful extensions: 3078 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3077 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)