| Clone Name | rbaet119b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CET1_DEBHA (Q6BND2) mRNA capping enzyme beta subunit (EC 3.1.3.3... | 28 | 6.6 | 2 | PKND_CHLPN (Q9Z986) Serine/threonine-protein kinase pknD (EC 2.7... | 28 | 8.6 |
|---|
>CET1_DEBHA (Q6BND2) mRNA capping enzyme beta subunit (EC 3.1.3.33)| (Polynucleotide 5'-triphosphatase) (mRNA 5'-triphosphatase) (TPase) Length = 476 Score = 28.5 bits (62), Expect = 6.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 8 NLLNIPCPSPHHITNSTYQAWKKQAHYNYR 97 NLLN P P+ T T + W + H N+R Sbjct: 40 NLLNDPAPNNELKTKETKKDWSEDEHSNFR 69
>PKND_CHLPN (Q9Z986) Serine/threonine-protein kinase pknD (EC 2.7.11.1)| Length = 932 Score = 28.1 bits (61), Expect = 8.6 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +3 Query: 81 LTTITEQQSSLRLLHDIGSYKLHGH*LAS*SGRTSVLVRDQKPI 212 L + + SL L D ++ +H + L S SGR +++VRD + I Sbjct: 418 LIALEQHNHSLSLFVDGTTWLIHMNYLPSRSGRVAIIVRDMEDI 461 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,996,794 Number of Sequences: 219361 Number of extensions: 833731 Number of successful extensions: 2880 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2869 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)