| Clone Name | rbaet119a09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GR33A_DROME (Q9VKA5) Putative gustatory receptor 33a | 29 | 5.2 |
|---|
>GR33A_DROME (Q9VKA5) Putative gustatory receptor 33a| Length = 475 Score = 29.3 bits (64), Expect = 5.2 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 7/63 (11%) Frame = +1 Query: 154 MRTHQLYPNKPSNQITQDKRSNQSCS-------WSSALRRNGLNLVTLTMTSCFMTISAS 312 M H++ KP+ ++ D N+ S W + NG+ L L T F T+SA+ Sbjct: 393 MIVHEIMQKKPAFMLSNDLFYNKMKSFTLQFLHWEGFFQFNGVGLFALDYTFIFSTVSAA 452 Query: 313 AGH 321 + Sbjct: 453 TSY 455 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,472,528 Number of Sequences: 219361 Number of extensions: 968214 Number of successful extensions: 2377 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2373 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)