| Clone Name | rbaet119a05 |
|---|---|
| Clone Library Name | barley_pub |
>CTR1_HUMAN (P30825) High-affinity cationic amino acid transporter 1 (CAT-1)| (CAT1) (System Y+ basic amino acid transporter) (Ecotropic retroviral leukemia receptor homolog) (ERR) (Ecotropic retrovirus receptor homolog) Length = 629 Score = 29.3 bits (64), Expect = 4.3 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +1 Query: 199 IQQDIDAWIQSSILMLLSGVMVLGILLWHRVEHVLCANRRLHRSGGL 339 +Q D W++ ++ ML+ ++ G LWH E L A++ G L Sbjct: 579 MQLDQGTWVRFAVWMLIGFIIYFGYGLWHSEEASLDADQARTPDGNL 625
>EFG_THEFY (Q47LJ0) Elongation factor G (EF-G)| Length = 704 Score = 29.3 bits (64), Expect = 4.3 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +1 Query: 289 VEHVLCANRRLHRSGG-LPALCYSIIRGTHHHHGANTVVDAVIAHTPEP 432 VE ++ A RR SG +P LC S + + G ++DA++A+ P P Sbjct: 240 VEQLVAAIRRATISGAAVPVLCGSAFK----NKGVQPLLDAIVAYLPSP 284
>CLS1_BACSU (P45860) Probable cardiolipin synthetase 1 (EC 2.7.8.-)| (Cardiolipin synthase 1) (CL synthase 1) Length = 500 Score = 29.3 bits (64), Expect = 4.3 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 9 CLISIIWYPISTKVLENKCSPNTSEWKH 92 C ISII + I + +LEN+ S +T W H Sbjct: 37 CYISIILFSIYSLILENRTSQHTLLWIH 64
>TILS_XANAC (Q8PIY5) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 440 Score = 28.9 bits (63), Expect = 5.7 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = +1 Query: 235 ILMLLSGVMVLGILLWHRVEHVLCANRRLHRSGGLPALCYSIIRGTHHHHGANTVVDAVI 414 +L+ SG M +LL H+L A R +G +R H HHG + DA Sbjct: 23 VLLAYSGGMDSSVLL-----HLLAARPRYRHAG---------LRALHVHHGLHADADAWA 68 Query: 415 AH 420 AH Sbjct: 69 AH 70
>CD97_HUMAN (P48960) CD97 antigen precursor (Leukocyte antigen CD97)| Length = 835 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 170 CWLSATSGFLLSTLAVC*TFTVLCLSVLPL*CIW 69 CWL GFL S L TF +LC +V+ + +W Sbjct: 684 CWLDFEQGFLWSFLGPV-TFIILCNAVIFVTTVW 716
>G6PI_SYMTH (Q67QQ0) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI)| (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) Length = 448 Score = 28.1 bits (61), Expect = 9.7 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 253 GVMVLGILLWHRVEHV-LCANRRLHRSGGLPALCYSIIRGTHHHHG 387 G+ LG H V H A R H GG+P L ++ T +H+G Sbjct: 349 GLGFLGGQTLHHVNHTAFLATRLAHTEGGVPNLTLTLPELTPYHYG 394 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,043,281 Number of Sequences: 219361 Number of extensions: 1028072 Number of successful extensions: 3041 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3040 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)