| Clone Name | rbaet117h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OLFM_RANCA (Q07081) Olfactomedin precursor (Olfactory mucus prot... | 30 | 1.3 | 2 | SESN1_MOUSE (P58006) Sestrin-1 (p53-regulated protein PA26) | 28 | 6.6 |
|---|
>OLFM_RANCA (Q07081) Olfactomedin precursor (Olfactory mucus protein)| Length = 464 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 138 YICLCTVVNLHFCLFLLASNVAGETRGNLDCLC 40 YICL T+V +H +A N G G C+C Sbjct: 2 YICLLTLVLIHAAAAFVAQNATGILAGKDHCVC 34
>SESN1_MOUSE (P58006) Sestrin-1 (p53-regulated protein PA26)| Length = 492 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -2 Query: 195 CSVSPP--CDVDHTIQMQDLTYICLCTVVNLHFCLFLLASNVAG 70 C +SP CD HT + ++ C+C + N + + + N AG Sbjct: 219 CGISPEIHCDGGHTFRPPSVSNYCICDITNGNHSVDEMQVNSAG 262 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,690,567 Number of Sequences: 219361 Number of extensions: 369076 Number of successful extensions: 994 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 994 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)