| Clone Name | rbaet117h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PEX10_ARATH (Q9SYU4) Peroxisome assembly protein 10 (Peroxin-10)... | 30 | 1.4 | 2 | FBRL_CAEEL (Q22053) Fibrillarin | 30 | 1.8 | 3 | SLA1_YEAST (P32790) Cytoskeleton assembly control protein SLA1 | 27 | 8.9 |
|---|
>PEX10_ARATH (Q9SYU4) Peroxisome assembly protein 10 (Peroxin-10) (AthPEX10)| (Pex10p) (PER8) Length = 381 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 338 PGRGGDSGGID-VELALQPEPMQRLEKDDEF 249 PG G GGI LA QPE M+ EKDD++ Sbjct: 14 PGSSGFHGGIRRFPLAAQPEIMRAAEKDDQY 44
>FBRL_CAEEL (Q22053) Fibrillarin| Length = 352 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 401 GRPERVRSGGNNKFDGMVYLYPGRGGDSGG 312 GRPE R GG F G GRGGD GG Sbjct: 2 GRPEFNRGGGGGGFRG------GRGGDRGG 25
>SLA1_YEAST (P32790) Cytoskeleton assembly control protein SLA1| Length = 1244 Score = 27.3 bits (59), Expect = 8.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 310 MPPLSPPRPGYRYTIPSNLLFPP 378 +PP+ PPRP ++P+ PP Sbjct: 620 LPPIKPPRPTSTTSVPNTTSVPP 642 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,304,856 Number of Sequences: 219361 Number of extensions: 829999 Number of successful extensions: 1973 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1971 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)