| Clone Name | rbaet117g04 |
|---|---|
| Clone Library Name | barley_pub |
>PAL1_ORYSA (P14717) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 701 Score = 124 bits (310), Expect = 1e-28 Identities = 57/62 (91%), Positives = 59/62 (95%) Frame = -2 Query: 450 SRSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLP 271 SRSFPLYRFVREELGCV+LTGEKL SPGEEC KVFLGISQ KLIDPML+CLKEWNGEPLP Sbjct: 640 SRSFPLYRFVREELGCVFLTGEKLKSPGEECNKVFLGISQGKLIDPMLDCLKEWNGEPLP 699 Query: 270 IN 265 IN Sbjct: 700 IN 701
>PAL1_RUBID (Q9M568) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5) (RiPAL1)| Length = 710 Score = 98.2 bits (243), Expect = 8e-21 Identities = 45/61 (73%), Positives = 50/61 (81%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVREELG LTGEK+ SPGEEC KVF I KL+DP+LECLKEWNG PLPI Sbjct: 650 RSYPLYRFVREELGTSLLTGEKIKSPGEECYKVFNAICAGKLVDPLLECLKEWNGAPLPI 709 Query: 267 N 265 + Sbjct: 710 S 710
>PAL2_ORYSA (P53443) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 710 Score = 97.8 bits (242), Expect = 1e-20 Identities = 45/60 (75%), Positives = 50/60 (83%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVREELG YLTGEK SPGEE KV + I++ K IDP+LECLKEWNGEPLPI Sbjct: 650 RSYPLYRFVREELGTKYLTGEKTRSPGEELNKVLVAINEGKHIDPLLECLKEWNGEPLPI 709
>PAL2_PHAVU (P19142) Phenylalanine ammonia-lyase class 2 (EC 4.3.1.5)| (Phenylalanine ammonia-lyase class II) Length = 712 Score = 96.7 bits (239), Expect = 2e-20 Identities = 43/60 (71%), Positives = 50/60 (83%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK++SPGEEC KVF + Q K+IDP+LECL EWNG PLPI Sbjct: 652 RSYPLYKFVREELGTSLLTGEKVISPGEECDKVFSAMCQGKIIDPLLECLGEWNGAPLPI 711
>PAL2_PEA (Q04593) Phenylalanine ammonia-lyase 2 (EC 4.3.1.5)| Length = 724 Score = 96.3 bits (238), Expect = 3e-20 Identities = 42/61 (68%), Positives = 51/61 (83%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK++SPGEEC K+F I Q K+IDP+LECL +WNG PLPI Sbjct: 664 RSYPLYKFVREELGTSLLTGEKVISPGEECDKLFTAICQGKIIDPLLECLGDWNGAPLPI 723 Query: 267 N 265 + Sbjct: 724 S 724
>PAL1_PRUAV (O64963) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5)| Length = 717 Score = 95.9 bits (237), Expect = 4e-20 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG YLTGEK+ SPGEEC KVF I + K+IDP+L+CL+ WNG PLPI Sbjct: 657 RSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGAPLPI 716
>PALY_POPTR (P45730) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 715 Score = 95.1 bits (235), Expect = 7e-20 Identities = 44/60 (73%), Positives = 49/60 (81%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG V LTGEK+ SPGEE KVF + Q K+IDPMLECL EWNG PLPI Sbjct: 655 RSYPLYKFVREELGTVLLTGEKVQSPGEEFDKVFTAMCQGKIIDPMLECLGEWNGSPLPI 714
>PAL1_PEA (Q01861) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5)| Length = 723 Score = 94.7 bits (234), Expect = 9e-20 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVR+ELG LTGEK++SPGEEC K+F I Q K+IDP+L+CL +WNG PLPI Sbjct: 663 RSYPLYRFVRQELGTGLLTGEKVISPGEECDKLFTAICQGKIIDPLLQCLGDWNGAPLPI 722 Query: 267 N 265 + Sbjct: 723 S 723
>PALY_WHEAT (Q43210) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 700 Score = 94.4 bits (233), Expect = 1e-19 Identities = 43/60 (71%), Positives = 50/60 (83%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVR+ELG YLTGEK SPGEE KVF+ ++Q K ID +LECLKEWNGEPLP+ Sbjct: 640 RSYPLYRFVRKELGTEYLTGEKTRSPGEEVDKVFVAMNQGKHIDALLECLKEWNGEPLPL 699
>PALY_MALDO (P35512) Phenylalanine ammonia-lyase (EC 4.3.1.5) (Fragment)| Length = 235 Score = 94.0 bits (232), Expect = 2e-19 Identities = 43/60 (71%), Positives = 49/60 (81%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG YLTGEK+ SPGEEC KVF I Q K+IDP+L CL+ WNG PLPI Sbjct: 175 RSYPLYKFVREELGGEYLTGEKVRSPGEECDKVFQAICQGKIIDPILGCLEGWNGAPLPI 234
>PAL1_TOBAC (P25872) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 715 Score = 93.6 bits (231), Expect = 2e-19 Identities = 42/60 (70%), Positives = 48/60 (80%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVR+ELG LTGEK+ SPGEEC KVF + ++IDPMLECLK WNG PLPI Sbjct: 655 RSYPLYRFVRKELGTELLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGAPLPI 714
>PALY_TRISU (P45734) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 725 Score = 93.2 bits (230), Expect = 3e-19 Identities = 40/60 (66%), Positives = 50/60 (83%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGE+++SPGEEC K+F + Q K+IDP+L+CL EWNG PLPI Sbjct: 665 RSYPLYKFVREELGTSLLTGERVISPGEECDKLFTAMCQGKIIDPLLKCLGEWNGAPLPI 724
>PALY_MEDSA (P27990) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 725 Score = 93.2 bits (230), Expect = 3e-19 Identities = 41/60 (68%), Positives = 49/60 (81%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGE ++SPGEEC K+F + Q K+IDP+LECL EWNG PLPI Sbjct: 665 RSYPLYKFVREELGTGLLTGENVISPGEECDKLFSAMCQGKIIDPLLECLGEWNGAPLPI 724
>PAL1_ARATH (P35510) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5)| Length = 725 Score = 93.2 bits (230), Expect = 3e-19 Identities = 42/60 (70%), Positives = 48/60 (80%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVREELG LTGEK+ SPGEE KVF I + K+IDPM+ECL EWNG P+PI Sbjct: 665 RSYPLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNGAPIPI 724
>PAL3_TOBAC (P45733) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 712 Score = 93.2 bits (230), Expect = 3e-19 Identities = 42/60 (70%), Positives = 48/60 (80%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVREELG LTGEK+ SPGEEC KVF + ++ID +LECLKEWNG PLPI Sbjct: 652 RSYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPI 711
>PAL2_ARATH (P45724) Phenylalanine ammonia-lyase 2 (EC 4.3.1.5)| Length = 717 Score = 93.2 bits (230), Expect = 3e-19 Identities = 41/60 (68%), Positives = 50/60 (83%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVREELG LTGEK++SPGEE KVF + + KLIDP+++CLKEWNG P+PI Sbjct: 657 RSYPLYRFVREELGTKLLTGEKVVSPGEEFDKVFTAMCEGKLIDPLMDCLKEWNGAPIPI 716
>PAL2_CICAR (Q9SMK9) Phenylalanine ammonia-lyase 2 (EC 4.3.1.5)| Length = 718 Score = 93.2 bits (230), Expect = 3e-19 Identities = 41/60 (68%), Positives = 47/60 (78%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVRE LG LTGEK+ SPGEEC KVF + + IDPML+CLKEWNG PLPI Sbjct: 658 RSYPLYKFVRENLGTSLLTGEKIRSPGEECDKVFAALCDGRFIDPMLDCLKEWNGAPLPI 717
>PALY_STYHU (P45732) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 715 Score = 92.8 bits (229), Expect = 3e-19 Identities = 40/60 (66%), Positives = 49/60 (81%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK+ SPGEEC K+F + Q K+IDP+LEC+ EWNG PLP+ Sbjct: 655 RSYPLYKFVREELGTEMLTGEKVRSPGEECDKLFTAMCQGKIIDPLLECIGEWNGAPLPL 714
>PAL3_PETCR (P45729) Phenylalanine ammonia-lyase 3 (EC 4.3.1.5)| Length = 718 Score = 92.4 bits (228), Expect = 5e-19 Identities = 41/60 (68%), Positives = 50/60 (83%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG YLTGEK+ SPGEE KVF +S+ ++IDP+LECL+ WNG PLPI Sbjct: 658 RSYPLYKFVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGEIIDPLLECLESWNGAPLPI 717
>PAL2_PETCR (P45728) Phenylalanine ammonia-lyase 2 (EC 4.3.1.5)| Length = 716 Score = 92.4 bits (228), Expect = 5e-19 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVR+ELG YLTGEK+ SPGEE KVF+ +S+ ++IDP+LECL+ WNG PLPI Sbjct: 656 RSYPLYKFVRKELGIEYLTGEKVTSPGEEFDKVFIAMSKGEIIDPLLECLESWNGAPLPI 715
>PAL1_PETCR (P24481) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5)| Length = 716 Score = 92.4 bits (228), Expect = 5e-19 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVR+ELG YLTGEK+ SPGEE KVF+ +S+ ++IDP+LECL+ WNG PLPI Sbjct: 656 RSYPLYKFVRKELGTEYLTGEKVTSPGEEFEKVFIAMSKGEIIDPLLECLESWNGAPLPI 715
>PAL1_DAUCA (O23865) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5)| Length = 708 Score = 92.4 bits (228), Expect = 5e-19 Identities = 40/60 (66%), Positives = 50/60 (83%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+F+REELG VYLTGEK+ SPGEE KVF +S+ ++IDP+L CL+ WNG PLPI Sbjct: 648 RSYPLYKFIREELGTVYLTGEKVTSPGEEFDKVFTAMSKGEIIDPLLACLESWNGAPLPI 707
>PAL2_POPKI (Q43052) Phenylalanine ammonia-lyase G2B (EC 4.3.1.5)| Length = 710 Score = 91.7 bits (226), Expect = 8e-19 Identities = 43/60 (71%), Positives = 48/60 (80%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK+ SPGEE KVF I KLIDP+LECLKEW+G PLPI Sbjct: 650 RSYPLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDGAPLPI 709
>PAL1_POPKI (P45731) Phenylalanine ammonia-lyase G1 (EC 4.3.1.5)| Length = 682 Score = 91.3 bits (225), Expect = 1e-18 Identities = 42/60 (70%), Positives = 48/60 (80%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK+ SPGE+ KVF I KL+DP+LECLKEWNG PLPI Sbjct: 622 RSYPLYKFVREELGTSLLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNGAPLPI 681
>PALY_DIGLA (O23924) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 713 Score = 90.9 bits (224), Expect = 1e-18 Identities = 37/60 (61%), Positives = 51/60 (85%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+F+REELG +LTGEK++SPGEEC +VF +S+ ++DP+L+CL+ WNG PLPI Sbjct: 653 RSYPLYKFIREELGTNFLTGEKVMSPGEECDRVFTAMSKGLIVDPLLKCLEGWNGAPLPI 712
>PAL1_PHAVU (P07218) Phenylalanine ammonia-lyase class 1 (EC 4.3.1.5)| (Phenylalanine ammonia-lyase class I) (Fragment) Length = 506 Score = 90.9 bits (224), Expect = 1e-18 Identities = 42/60 (70%), Positives = 48/60 (80%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK+ SPGEE K+F I Q K+IDP+LECL EWNG PLPI Sbjct: 446 RSYPLYKFVREELGTGLLTGEKVKSPGEEFDKLFTAICQGKIIDPLLECLGEWNGAPLPI 505
>PAL2_TOBAC (P35513) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 712 Score = 90.5 bits (223), Expect = 2e-18 Identities = 41/60 (68%), Positives = 47/60 (78%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVR ELG LTGEK+ SPGEEC KVF + ++ID +LECLKEWNG PLPI Sbjct: 652 RSYPLYRFVRGELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGAPLPI 711
>PALY_CITLI (Q42667) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 722 Score = 90.5 bits (223), Expect = 2e-18 Identities = 41/60 (68%), Positives = 48/60 (80%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+ VRE++G LTGEK+ SPGEE KVF + + KLIDPMLECLKEWNG PLPI Sbjct: 660 RSYPLYKIVREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNGAPLPI 719
>PAL1_SOYBN (P27991) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5)| Length = 713 Score = 89.4 bits (220), Expect = 4e-18 Identities = 40/61 (65%), Positives = 49/61 (80%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK+ SPGEE K+F + Q K+IDP++ECL EWNG PLPI Sbjct: 653 RSYPLYKFVREELGTGLLTGEKVRSPGEEFDKLFTAMCQGKIIDPLMECLGEWNGAPLPI 712 Query: 267 N 265 + Sbjct: 713 S 713
>PALY_PERAE (P45727) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 620 Score = 89.4 bits (220), Expect = 4e-18 Identities = 41/60 (68%), Positives = 48/60 (80%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREEL LTGEK+ SPGEE KVF I Q K+IDP+LECL+EWNG P+PI Sbjct: 560 RSYPLYKFVREELKTSLLTGEKVRSPGEEFDKVFSAICQGKVIDPLLECLREWNGAPIPI 619
>PAL4_ARATH (Q9SS45) Phenylalanine ammonia-lyase 4 (EC 4.3.1.5)| Length = 707 Score = 89.4 bits (220), Expect = 4e-18 Identities = 42/60 (70%), Positives = 47/60 (78%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVR+EL LTGE + SPGEE KVFL IS KLIDP+LECLKEWNG P+ I Sbjct: 647 RSYPLYRFVRDELNTELLTGENVRSPGEEFDKVFLAISDGKLIDPLLECLKEWNGAPVSI 706
>PALY_CAMSI (P45726) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 714 Score = 89.4 bits (220), Expect = 4e-18 Identities = 39/60 (65%), Positives = 49/60 (81%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK+ SPGEE KVF + + ++IDP+++CLKEWNG PLPI Sbjct: 654 RSYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGAPLPI 713
>PAL1_LYCES (P35511) Phenylalanine ammonia-lyase (EC 4.3.1.5) (PAL)| Length = 704 Score = 89.0 bits (219), Expect = 5e-18 Identities = 41/60 (68%), Positives = 46/60 (76%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYR VREELG LTGEK+ SPGEE KVF I ++IDP+LECLK WNG PLPI Sbjct: 644 RSYPLYRLVREELGTELLTGEKVRSPGEEIDKVFTAICNGQIIDPLLECLKSWNGAPLPI 703
>PAL1_IPOBA (P14166) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 707 Score = 88.6 bits (218), Expect = 7e-18 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVRE LG LTGEK+ SPGEEC KVF + + +IDP+LECLK W+G PLPI Sbjct: 647 RSYPLYKFVREGLGTELLTGEKVRSPGEECDKVFTAMCEGSIIDPLLECLKSWDGAPLPI 706
>PAL2_IPOBA (Q42858) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 708 Score = 87.8 bits (216), Expect = 1e-17 Identities = 39/60 (65%), Positives = 46/60 (76%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK+ SPGE C KVF + +IDP+LECLK W+G PLPI Sbjct: 648 RSYPLYKFVREELGTEMLTGEKVKSPGEVCDKVFTAVCDGGIIDPLLECLKSWDGAPLPI 707
>PAL1_LITER (O49835) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5) (PAL-1)| Length = 710 Score = 87.4 bits (215), Expect = 1e-17 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK+ SPGEE KVF + + KL+DP+L CL+ WNG PLPI Sbjct: 650 RSYPLYKFVREELGTELLTGEKVRSPGEELDKVFTAMCEGKLVDPLLACLEAWNGAPLPI 709
>PAL3_PHAVU (P19143) Phenylalanine ammonia-lyase class 3 (EC 4.3.1.5)| (Phenylalanine ammonia-lyase class III) Length = 710 Score = 86.3 bits (212), Expect = 3e-17 Identities = 39/60 (65%), Positives = 48/60 (80%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK LSP EE KV+ + Q K+IDP+LECL++WNG P+PI Sbjct: 651 RSYPLYKFVREELGIRLLTGEKALSPDEEFEKVYTAMCQAKIIDPILECLEDWNGVPIPI 710
>PALY_VITVI (P45735) Phenylalanine ammonia-lyase (EC 4.3.1.5) (Fragment)| Length = 416 Score = 85.9 bits (211), Expect = 4e-17 Identities = 38/60 (63%), Positives = 47/60 (78%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG LTGEK+ SPGE+ KVF + + K+IDP+L+CL WNG PLPI Sbjct: 356 RSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGAPLPI 415
>PALY_BROFI (Q42609) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 703 Score = 85.5 bits (210), Expect = 6e-17 Identities = 40/60 (66%), Positives = 49/60 (81%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FV+E +G +LTGEK++SPGEE KVF I + K IDPML+CLKEWNG PLPI Sbjct: 644 RSYPLYKFVKE-VGSGFLTGEKVVSPGEEFDKVFNAICEGKAIDPMLDCLKEWNGAPLPI 702
>PAL4_POPKI (Q40910) Phenylalanine ammonia-lyase G4 (EC 4.3.1.5) (Fragment)| Length = 571 Score = 85.1 bits (209), Expect = 7e-17 Identities = 41/60 (68%), Positives = 45/60 (75%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVREELG V LTGEK+ SPGEE KVF I KLIDP LKEWNG PLP+ Sbjct: 511 RSYPLYKFVREELGTVLLTGEKVGSPGEEFDKVFTAICAGKLIDPCWSVLKEWNGAPLPL 570
>PAL5_LYCES (P26600) Phenylalanine ammonia-lyase (EC 4.3.1.5) (PAL)| Length = 721 Score = 84.3 bits (207), Expect = 1e-16 Identities = 37/60 (61%), Positives = 45/60 (75%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYR VR+E+G LTGEK+ SPGEE KVF ++IDP+LECLK WNG P+PI Sbjct: 661 RSYPLYRLVRQEVGTELLTGEKVRSPGEEIDKVFTAFCNGQIIDPLLECLKSWNGAPIPI 720
>PAL3_ARATH (P45725) Phenylalanine ammonia-lyase 3 (EC 4.3.1.5)| Length = 694 Score = 84.3 bits (207), Expect = 1e-16 Identities = 40/60 (66%), Positives = 45/60 (75%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYRFVR EL LTGE + SPGE+ KVF ISQ KLIDP+ ECLKEWNG P+ I Sbjct: 634 RSYPLYRFVRNELETRLLTGEDVRSPGEDFDKVFRAISQGKLIDPLFECLKEWNGAPISI 693
>PAL1_SOLTU (P31425) Phenylalanine ammonia-lyase 1 (EC 4.3.1.5)| Length = 720 Score = 84.0 bits (206), Expect = 2e-16 Identities = 38/60 (63%), Positives = 45/60 (75%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLYR VR+ELG LTGEK+ SPGEE KVF + ++ DP+LECLK WNG PLPI Sbjct: 660 RSYPLYRLVRQELGTELLTGEKVRSPGEEIEKVFTAMCNGQINDPLLECLKSWNGAPLPI 719
>PAL2_LITER (O49836) Phenylalanine ammonia-lyase 2 (EC 4.3.1.5) (PAL-2)| Length = 705 Score = 82.8 bits (203), Expect = 4e-16 Identities = 37/60 (61%), Positives = 46/60 (76%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNGEPLPI 268 RS+PLY+FVR ELG LTGEK+ SPGEE +VF + + KL+DP+L CL+ WNG PLPI Sbjct: 645 RSYPLYKFVRGELGTELLTGEKVRSPGEELDQVFNALCEGKLVDPLLACLEAWNGAPLPI 704
>PALY_PINTA (P52777) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 754 Score = 58.5 bits (140), Expect = 7e-09 Identities = 26/55 (47%), Positives = 37/55 (67%) Frame = -2 Query: 447 RSFPLYRFVREELGCVYLTGEKLLSPGEECTKVFLGISQNKLIDPMLECLKEWNG 283 RS+PLY FVR +LG L+G + +SPGE V+ IS++K+I P+ +CL W G Sbjct: 659 RSYPLYEFVRNQLGTKLLSGTRTISPGEVIEVVYDAISEDKVIVPLFKCLDGWKG 713
>DTX1_HUMAN (Q86Y01) Protein deltex-1 (Deltex-1) (Deltex1) (hDTX1)| Length = 620 Score = 34.7 bits (78), Expect = 0.11 Identities = 25/77 (32%), Positives = 36/77 (46%) Frame = +1 Query: 37 PQNTTTISVGKAAGPPWLSSYTINNIRRSTPTHEQVKAKATGTEVRTCTNGLSVLFLDVL 216 PQ TT++S +A+ PP + + + N+ + P H A A T + C GL V Sbjct: 299 PQRTTSVSA-RASIPPGVPALPVKNLNGTGPVH---PALAGMTGILLCAAGLPVCLTRA- 353 Query: 217 WKPPPLLHGGTDDPSDV 267 P P+LH SDV Sbjct: 354 --PKPILHPPPVSKSDV 368
>YGY3_HALSQ (P21561) Hypothetical 50.6 kDa protein in the 5'region of gyrA and| gyrB (ORF 3) Length = 437 Score = 33.1 bits (74), Expect = 0.33 Identities = 32/95 (33%), Positives = 39/95 (41%), Gaps = 26/95 (27%) Frame = -1 Query: 442 VPAVPLRPRGARLR-VPHRREAAVPRR--------GMHQGLPRH---------------Q 335 V VPLR R R+R VP R + PRR G H+G RH Q Sbjct: 76 VEHVPLRGRHPRVRRVPQRDQDGAPRRRHLLRRRVGGHRGRNRHAGDRRAPGVDSRLRQQ 135 Query: 334 PEQAHRPHA--RVPQGVERRAPAHQRLKDRPCHRG 236 + HA RV G P QRL+++P H G Sbjct: 136 HQHPRGRHASDRVQDGAH---PRRQRLREQPRHAG 167 Score = 29.6 bits (65), Expect = 3.6 Identities = 28/75 (37%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Frame = -1 Query: 421 PRGARLRVPHRREAAVPRRGMHQGLPRHQPEQAHRPHARVP------QGVERRAPAHQRL 260 PRG R ++ A PRR Q L R QP A RP R P +G RR H R Sbjct: 139 PRG-RHASDRVQDGAHPRR---QRL-REQPRHAGRPRRRQPPRRGRSRGTHRR---HLRQ 190 Query: 259 KDRPCHRGGEEEASK 215 RP RG +E+ ++ Sbjct: 191 APRPAVRGPDEDQAR 205
>AMY_STRLI (Q05884) Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan| glucanohydrolase) Length = 919 Score = 32.3 bits (72), Expect = 0.56 Identities = 28/72 (38%), Positives = 32/72 (44%), Gaps = 6/72 (8%) Frame = -1 Query: 418 RGARLRVPHRREAAVPRRGMHQGLP--RHQPEQAHRPHAR----VPQGVERRAPAHQRLK 257 R A R+ HR A R G H+ LP R +P QA R R V G RR AH + Sbjct: 702 RTASGRLHHRHPAR--RGGAHRRLPGPRGRPLQARRRELRRLGPVRLGRPRRREAHHLAR 759 Query: 256 DRPCHRGGEEEA 221 P HR G A Sbjct: 760 HPPLHRPGRLRA 771
>UBP42_HUMAN (Q9H9J4) Ubiquitin carboxyl-terminal hydrolase 42 (EC 3.1.2.15)| (Ubiquitin thioesterase 42) (Ubiquitin-specific-processing protease 42) (Deubiquitinating enzyme 42) Length = 1325 Score = 31.6 bits (70), Expect = 0.95 Identities = 26/79 (32%), Positives = 30/79 (37%), Gaps = 4/79 (5%) Frame = -1 Query: 430 PLRPRGARLRVPHRREAAVPRRG---MHQGLPRHQPEQAHRPHARVPQGVERRAPAHQRL 260 P RPR R R H R A R H G + RPH +G PA +R Sbjct: 1051 PDRPRWDRCRYYHDRYALYAARDWKPFHGGREHERAGLHERPHKDHNRGRRGCEPARERE 1110 Query: 259 KDRPCH-RGGEEEASKVHP 206 + RP R G A HP Sbjct: 1111 RHRPSSPRAGAPHALAPHP 1129
>PALY_HELAN (O04058) Phenylalanine ammonia-lyase (EC 4.3.1.5)| Length = 667 Score = 31.6 bits (70), Expect = 0.95 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -2 Query: 447 RSFPLYRFVREELG 406 RS+PLYRFVREELG Sbjct: 651 RSYPLYRFVREELG 664
>KRUH_DROME (P08155) Krueppel homologous protein 1| Length = 845 Score = 31.6 bits (70), Expect = 0.95 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 11/82 (13%) Frame = -1 Query: 406 LRVPHRREAAVPRRGMHQ-----------GLPRHQPEQAHRPHARVPQGVERRAPAHQRL 260 L+ P +R+ + + HQ + +HQ +Q + H + AP+ QR+ Sbjct: 107 LQTPQQRQMQLQLQDQHQQEQQQFVSYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRI 166 Query: 259 KDRPCHRGGEEEASKVHPKIRR 194 K P GG ++ V ++R+ Sbjct: 167 KTEPV--GGFPASAAVVSQVRK 186
>PQE1_CAEEL (Q10124) Putative RNA exonuclease pqe-1 (PolyQ enhancer protein 1)| Length = 1647 Score = 31.2 bits (69), Expect = 1.2 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -1 Query: 448 QVVPAVPLRPRGARLRVPHRREAAVPRR-GMHQGL-PRHQPEQAHRPHARVPQGVERRAP 275 Q + P R R A ++ + P++ M QG+ P H P QA PH PQ + ++AP Sbjct: 270 QTIQQTPARGRPANAQLAQNAQQRNPQQVPMPQGVAPHHIPPQALGPHGAAPQ-MTQQAP 328 Query: 274 A 272 A Sbjct: 329 A 329
>ATPG_STRLI (P50007) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 302 Score = 31.2 bits (69), Expect = 1.2 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 5/40 (12%) Frame = +1 Query: 241 GGTDDPSDVDGQGLAVPLLEALEH-----GVDELVLADAE 345 G TD+P+ D + +A PL+EA+E GVDEL + E Sbjct: 137 GFTDEPTYADAKKVAAPLIEAIEKDTAEGGVDELHIVYTE 176
>ATPG_STRCO (Q9K4D4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 305 Score = 31.2 bits (69), Expect = 1.2 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 5/40 (12%) Frame = +1 Query: 241 GGTDDPSDVDGQGLAVPLLEALEH-----GVDELVLADAE 345 G TD+P+ D + +A PL+EA+E GVDEL + E Sbjct: 140 GFTDEPTYADAKKVAAPLIEAIEKDTAEGGVDELHIVYTE 179
>CSKI1_HUMAN (Q8WXD9) Caskin-1 (CASK-interacting protein 1)| Length = 1431 Score = 31.2 bits (69), Expect = 1.2 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 272 GRGSPFHSLRHSSMGSMSLFWLMPRKTLVHSSPGDSSFSP 391 GRGS H+L S G L ++ +K++ S PGDS P Sbjct: 397 GRGSGGHALHAGSEGVKLLATVLSQKSVSESGPGDSPAKP 436
>QUTA_EMENI (P10563) Quinic acid utilization activator| Length = 825 Score = 30.8 bits (68), Expect = 1.6 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 281 SPFHSLRHSSMGSMSLFWLMPRKTLVHS-SPGDSSFSPVRYTQPSSSRTKRYSGNDLL 451 SP + S + +L W +P V S SP S SPVR +PS++R R SG + Sbjct: 176 SPADAEESSVLSPETLEWQLPDSIAVASQSPLASGPSPVRLPRPSTTRLVRDSGTQTI 233
>ATPG_STRAW (Q82J83) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 305 Score = 30.4 bits (67), Expect = 2.1 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 5/47 (10%) Frame = +1 Query: 220 KPPPLLHGGTDDPSDVDGQGLAVPLLEALEH-----GVDELVLADAE 345 K L G TD+P+ D + +A PL+EA+E GVDEL + E Sbjct: 133 KVTELWTGFTDEPTYADAKKVAGPLIEAIEKETADGGVDELHIVYTE 179
>MAGI1_HUMAN (Q96QZ7) Membrane-associated guanylate kinase, WW and PDZ| domain-containing protein 1 (BAI1-associated protein 1) (BAP-1) (Membrane-associated guanylate kinase inverted 1) (MAGI-1) (Atrophin-1-interacting protein 3) (AIP3) (WW domain-containi Length = 1491 Score = 30.4 bits (67), Expect = 2.1 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = -1 Query: 430 PLRPRGARLRVPHRREAAVPRRGMHQGLPRHQPEQAHRPHARVPQGVERRAPAHQRLKDR 251 P R R + R+ +R + RRG G P + + R AR P+ R+ + +DR Sbjct: 1396 PSRRRRSLERLLEQRRSPERRRG---GSPERRAKSTDRRRARSPERRRERSLDKRNREDR 1452 Query: 250 PCHRGGEE 227 HR EE Sbjct: 1453 ASHREREE 1460
>ZN219_HUMAN (Q9P2Y4) Zinc finger protein 219| Length = 722 Score = 30.0 bits (66), Expect = 2.8 Identities = 19/63 (30%), Positives = 25/63 (39%) Frame = -1 Query: 421 PRGARLRVPHRREAAVPRRGMHQGLPRHQPEQAHRPHARVPQGVERRAPAHQRLKDRPCH 242 P + PH A R + L HQPE+ P AR+ +E RA + R Sbjct: 80 PGAQAFQCPHCGHRAAQRALLRSHLRTHQPERPRSPAARLLLELEERALLREARLGRARS 139 Query: 241 RGG 233 GG Sbjct: 140 SGG 142
>FA5_HUMAN (P12259) Coagulation factor V precursor (Activated protein C| cofactor) [Contains: Coagulation factor V heavy chain; Coagulation factor V light chain] Length = 2224 Score = 30.0 bits (66), Expect = 2.8 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 2/91 (2%) Frame = +1 Query: 43 NTTTISVGKAAGPPWLSSYTINNIR--RSTPTHEQVKAKATGTEVRTCTNGLSVLFLDVL 216 NT I + P +S +T+NN+ + P+H+Q A G+ +R SVL Sbjct: 768 NTDIIVGSNYSSPSNISKFTVNNLAEPQKAPSHQQ--ATTAGSPLRHLIGKNSVLNSSTA 825 Query: 217 WKPPPLLHGGTDDPSDVDGQGLAVPLLEALE 309 P +DP D G+ + L A E Sbjct: 826 EHSSPYSEDPIEDPLQPDVTGIRLLSLGAGE 856
>VE4_HPV57 (P22157) Probable protein E4| Length = 124 Score = 30.0 bits (66), Expect = 2.8 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -1 Query: 355 QGLPRHQPEQAHRPHARVPQGVERRAPAHQRLKDRPCHRGGEEEASKVHPKIR 197 Q P+ QP+Q RPH+R P P R++ P G ++S P +R Sbjct: 45 QSQPQPQPQQQSRPHSRTP-------PRRHRVR-HPSASGSSSDSSGNSPTLR 89
>AROK_PYRKO (Q5JFT2) Shikimate kinase (EC 2.7.1.71) (SK)| Length = 271 Score = 29.6 bits (65), Expect = 3.6 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +2 Query: 212 YFGSLLLSSTVARTILQTLMGRGSPFHSLRHSSMGSMSLFWLMPRKTLVHSSPGDSSFSP 391 YFGSL ++ + +L + S + + + L+P KTL+ S G FSP Sbjct: 141 YFGSLWVTDNLGMRVLHS-------------SKVEPLPVVLLLPGKTLLTESLGGRDFSP 187 Query: 392 VR 397 +R Sbjct: 188 IR 189
>CSKI1_MOUSE (Q6P9K8) Caskin-1 (CASK-interacting protein 1)| Length = 1431 Score = 29.6 bits (65), Expect = 3.6 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +2 Query: 272 GRGSPFHSLRHSSMGSMSLFWLMPRKTLVHSSPGDSSFSP 391 GR + H+L S G L ++ +K++ SSPGDS P Sbjct: 397 GRSTGGHALHAGSEGVKLLATVLSQKSVSESSPGDSPVKP 436
>SNIP1_HUMAN (Q8TAD8) Smad nuclear-interacting protein 1| Length = 396 Score = 29.6 bits (65), Expect = 3.6 Identities = 22/60 (36%), Positives = 23/60 (38%), Gaps = 7/60 (11%) Frame = -1 Query: 421 PRGARLRVPHRREAAV-------PRRGMHQGLPRHQPEQAHRPHARVPQGVERRAPAHQR 263 PR R R PH V PRRG R EQ HR AR R +HQR Sbjct: 92 PRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHR-RARNSDRDRHRGHSHQR 150
>RIMB1_MOUSE (Q7TNF8) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1846 Score = 29.6 bits (65), Expect = 3.6 Identities = 21/60 (35%), Positives = 27/60 (45%) Frame = -1 Query: 403 RVPHRREAAVPRRGMHQGLPRHQPEQAHRPHARVPQGVERRAPAHQRLKDRPCHRGGEEE 224 R P RR A VPR G + P P++A PH +P V + + P GEEE Sbjct: 1584 RGPQRRGARVPRSGTTELAPPRSPQEA-PPHQDLPVRVFVALFDYDPVSMSPNPDAGEEE 1642
>STCA_EMENI (Q12397) Putative sterigmatocystin biosynthesis polyketide synthase| (PKS) Length = 2181 Score = 29.3 bits (64), Expect = 4.7 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = -1 Query: 376 VPRRGMHQGLPRHQPEQAHRPHARVPQGVERRAPAHQRLKDRPCHRGGEEEASKV 212 VPRRG+ L + ++A R H Q V+ +AP LK +P + ASKV Sbjct: 1626 VPRRGLRMVL-QQASDKAARLHGN-QQAVKTQAPQRAALKQKPQSSPTQPHASKV 1678
>YL116_MIMIV (Q5UPJ3) Hypothetical protein L116| Length = 563 Score = 29.3 bits (64), Expect = 4.7 Identities = 18/70 (25%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Frame = -1 Query: 412 ARLRVPHRREAAVPRRGMHQGLPRHQPEQAHRPHARVPQGVERRAP--AHQRLKDRPCHR 239 +R R P R P R ++ R + R R P+ R+P +H R DR +R Sbjct: 135 SRYRSPERSRYRSPERSRYRSPERSRYRSPERSRYRSPERSRYRSPERSHYRSPDRSHYR 194 Query: 238 GGEEEASKVH 209 + + H Sbjct: 195 SHNKSTERSH 204
>CWC22_MAGGR (Q52B63) Pre-mRNA-splicing factor CWC22| Length = 907 Score = 29.3 bits (64), Expect = 4.7 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = -1 Query: 439 PAVPLRPRG-ARLRVPHRREAAVPRRGMHQGLPRHQPEQ-AHRPHARVPQGVERRAPAHQ 266 PA P R +R P R A + R +G + P Q AH P R P+G +RRA + Sbjct: 21 PAAPSRSWSRSRHESPSRSPAPMRERREEEGNEQRSPRQIAHHP--RSPRGSDRRAEPRR 78 Query: 265 R 263 R Sbjct: 79 R 79
>SDK2_HUMAN (Q58EX2) Protein sidekick-2 precursor| Length = 2170 Score = 29.3 bits (64), Expect = 4.7 Identities = 22/72 (30%), Positives = 30/72 (41%), Gaps = 2/72 (2%) Frame = +1 Query: 121 STPTHEQVKAKATGTEV--RTCTNGLSVLFLDVLWKPPPLLHGGTDDPSDVDGQGLAVPL 294 S+P E +A T +G + LDV W+PPPL D + D QG + Sbjct: 1608 SSPPQEVFVGEAVPTAAPRNVVVHGATATQLDVTWEPPPL------DSQNGDIQGYKIYF 1661 Query: 295 LEALEHGVDELV 330 EA + E V Sbjct: 1662 WEAQRGNLTERV 1673
>Y3466_MYCTU (O06331) Hypothetical protein Rv3466/MT3572| Length = 222 Score = 28.9 bits (63), Expect = 6.2 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -1 Query: 436 AVPLRPRGARLRVPHRREAAVPRRGMHQGLPRHQPEQ 326 A PLRP G L P RR P R + RH PEQ Sbjct: 169 AGPLRPAGHGLATPRRR----PHRHRTRPQTRHHPEQ 201
>Y1614_MYCBO (P0A5F2) Hypothetical protein Mb1614c| Length = 222 Score = 28.9 bits (63), Expect = 6.2 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -1 Query: 436 AVPLRPRGARLRVPHRREAAVPRRGMHQGLPRHQPEQ 326 A PLRP G L P RR P R + RH PEQ Sbjct: 169 AGPLRPAGHGLATPRRR----PHRHRTRPQTRHHPEQ 201
>Y1588_MYCTU (P0A5F1) Hypothetical protein Rv1588c/MT1623| Length = 222 Score = 28.9 bits (63), Expect = 6.2 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -1 Query: 436 AVPLRPRGARLRVPHRREAAVPRRGMHQGLPRHQPEQ 326 A PLRP G L P RR P R + RH PEQ Sbjct: 169 AGPLRPAGHGLATPRRR----PHRHRTRPQTRHHPEQ 201
>DTX1_XENLA (Q8AW93) Protein deltex-1 (xDtx1)| Length = 623 Score = 28.9 bits (63), Expect = 6.2 Identities = 20/67 (29%), Positives = 30/67 (44%) Frame = +1 Query: 40 QNTTTISVGKAAGPPWLSSYTINNIRRSTPTHEQVKAKATGTEVRTCTNGLSVLFLDVLW 219 + T+ S +A+ PP + + + N+ S P H A A T + C GL V Sbjct: 301 EQRTSGSSSRASIPPGVPALPVKNLNGSGPVH---PALAGMTGILMCAAGLPVCLTRA-- 355 Query: 220 KPPPLLH 240 P P+LH Sbjct: 356 -PKPILH 361
>CYA1_DROME (P32870) Ca(2+)/calmodulin-responsive adenylate cyclase (EC 4.6.1.1)| (ATP pyrophosphate-lyase) (Protein rutabaga) Length = 2248 Score = 28.9 bits (63), Expect = 6.2 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 13/80 (16%) Frame = -1 Query: 436 AVPLRPRGARLRVPHRRE----AAVPRRGMHQGLPRHQPEQAHRPHARVPQGVERR---- 281 AVPL+P+ +L+ H + +AV HQ L HQ + H+P VP + R Sbjct: 1312 AVPLQPQHHQLQFQHPHQHPLPSAVSVPVQHQILLHHQLQLQHQP---VPSVMLREFNII 1368 Query: 280 -----APAHQRLKDRPCHRG 236 HQ+++ P H G Sbjct: 1369 ENPTSGGRHQQMEQLPPHHG 1388
>FGD1_HUMAN (P98174) FYVE, RhoGEF and PH domain-containing protein 1| (Faciogenital dysplasia 1 protein) (Zinc finger FYVE domain-containing protein 3) (Rho/Rac guanine nucleotide exchange factor FGD1) (Rho/Rac GEF) Length = 961 Score = 28.5 bits (62), Expect = 8.1 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 6/57 (10%) Frame = -1 Query: 448 QVVPAVPLRPRGARLRVPHRREAAVPRRGMHQG---LPRH---QPEQAHRPHARVPQ 296 +V+P P LR + E + PR G+HQG L + P Q+ PH PQ Sbjct: 75 RVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPGQSLEPHPEGPQ 131
>CSKI1_RAT (Q8VHK2) Caskin-1 (CASK-interacting protein 1)| Length = 1430 Score = 28.5 bits (62), Expect = 8.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 272 GRGSPFHSLRHSSMGSMSLFWLMPRKTLVHSSPGDSSFSP 391 GR + H+L + G L ++ +K++ SSPGDS P Sbjct: 397 GRSTGGHALHAGAEGVKLLATVLSQKSVSESSPGDSPVKP 436
>FGD1_MOUSE (P52734) FYVE, RhoGEF and PH domain-containing protein 1| (Faciogenital dysplasia 1 protein homolog) (Zinc finger FYVE domain-containing protein 3) (Rho/Rac guanine nucleotide exchange factor FGD1) (Rho/Rac GEF) Length = 960 Score = 28.5 bits (62), Expect = 8.1 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 6/57 (10%) Frame = -1 Query: 448 QVVPAVPLRPRGARLRVPHRREAAVPRRGMHQG---LPRH---QPEQAHRPHARVPQ 296 +V+P P LR + E + PR G+HQG L + P Q+ PH PQ Sbjct: 75 RVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPGQSLEPHPEGPQ 131
>CWC15_SCHPO (P78794) Pre-mRNA-splicing factor cwc15 (Complexed with cdc5| protein 15) (Cell cycle control protein cwf15) Length = 265 Score = 28.5 bits (62), Expect = 8.1 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -1 Query: 346 PRHQPEQAHRPHARVPQGVERRAPAHQRLKDRPCHRGGEEEASK 215 P+ P + H A R PAH +LK R +G EEE K Sbjct: 7 PQFDPARGHSEMAPTRITSSRALPAHLKLKYRQESQGTEEEVRK 50
>RLUB_PSEAE (Q9HZ55) Ribosomal large subunit pseudouridine synthase B (EC| 5.4.99.-) (rRNA-uridine isomerase B) (rRNA pseudouridylate synthase B) Length = 386 Score = 28.5 bits (62), Expect = 8.1 Identities = 23/86 (26%), Positives = 36/86 (41%), Gaps = 9/86 (10%) Frame = -1 Query: 424 RPRGARLRVPHRRE---------AAVPRRGMHQGLPRHQPEQAHRPHARVPQGVERRAPA 272 RP R R P R + A+ P RG R EQ P A P+ R+ Sbjct: 288 RPEAGRKRAPRREDGENAARRAPASRPARGPQPSAERKGREQG-TPVAERPRESNRKPRP 346 Query: 271 HQRLKDRPCHRGGEEEASKVHPKIRR 194 + +RP G++ A++ P+++R Sbjct: 347 SKPRDERPASAPGDKPAAR-KPQVKR 371
>MP2K1_CRIGR (Q63980) Dual specificity mitogen-activated protein kinase kinase 1| (EC 2.7.12.2) (MAP kinase kinase 1) (MAPKK 1) (ERK activator kinase 1) (MAPK/ERK kinase 1) (MEK1) Length = 393 Score = 28.5 bits (62), Expect = 8.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +1 Query: 220 KPPPLLHGGTDDPSDVDGQGLAVPLLEALEHGVDELVLADAEED 351 KP P+ T D S V+G A LEAL+ ++EL L + + + Sbjct: 5 KPTPIQLNPTPDGSAVNGTSSAETNLEALQKKLEELELEEQQRN 48
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 28.5 bits (62), Expect = 8.1 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 5/62 (8%) Frame = -1 Query: 397 PHRREAAVPRRGMHQGLPRHQPEQAHRPHARVPQGVER-----RAPAHQRLKDRPCHRGG 233 PHRR G + LPR QP P G ER R P L RP HR G Sbjct: 1709 PHRRRPPASHEGERKELPREQPLPPG------PIGTERSQRTDRGPEPGPL--RPAHRAG 1760 Query: 232 EE 227 + Sbjct: 1761 SQ 1762 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,562,646 Number of Sequences: 219361 Number of extensions: 1374331 Number of successful extensions: 4779 Number of sequences better than 10.0: 81 Number of HSP's better than 10.0 without gapping: 4534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4770 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)