| Clone Name | rbaet117e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YADD_ECOLI (P31665) Hypothetical protein yadD | 33 | 0.28 | 2 | UBF1_MOUSE (P25976) Nucleolar transcription factor 1 (Upstream-b... | 29 | 6.8 | 3 | UBF1_RAT (P25977) Nucleolar transcription factor 1 (Upstream-bin... | 29 | 6.8 | 4 | UBF1_HUMAN (P17480) Nucleolar transcription factor 1 (Upstream-b... | 29 | 6.8 | 5 | SYIC_MOUSE (Q8BU30) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6... | 28 | 8.9 |
|---|
>YADD_ECOLI (P31665) Hypothetical protein yadD| Length = 300 Score = 33.5 bits (75), Expect = 0.28 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 270 DHDALPLRV*I*FRPGAAAPAVRTLPWFCSFRAPDL 377 DHD LPL V I F G A P ++ WF F +P+L Sbjct: 109 DHDKLPLVVPILFYQGEATPYPLSMCWFDMFYSPEL 144
>UBF1_MOUSE (P25976) Nucleolar transcription factor 1 (Upstream-binding factor| 1) (UBF-1) Length = 765 Score = 28.9 bits (63), Expect = 6.8 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 446 EDHPDLLKYSCKVECKVRPVSPAKVW 369 EDHPDL++ + K + +P +P ++W Sbjct: 181 EDHPDLIQNAKKSDIPEKPKTPQQLW 206
>UBF1_RAT (P25977) Nucleolar transcription factor 1 (Upstream-binding factor| 1) (UBF-1) Length = 764 Score = 28.9 bits (63), Expect = 6.8 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 446 EDHPDLLKYSCKVECKVRPVSPAKVW 369 EDHPDL++ + K + +P +P ++W Sbjct: 181 EDHPDLIQNAKKSDIPEKPKTPQQLW 206
>UBF1_HUMAN (P17480) Nucleolar transcription factor 1 (Upstream-binding factor| 1) (UBF-1) (Autoantigen NOR-90) Length = 764 Score = 28.9 bits (63), Expect = 6.8 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 446 EDHPDLLKYSCKVECKVRPVSPAKVW 369 EDHPDL++ + K + +P +P ++W Sbjct: 181 EDHPDLIQNAKKSDIPEKPKTPQQLW 206
>SYIC_MOUSE (Q8BU30) Isoleucyl-tRNA synthetase, cytoplasmic (EC 6.1.1.5)| (Isoleucine--tRNA ligase) (IleRS) (IRS) Length = 1262 Score = 28.5 bits (62), Expect = 8.9 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 14/55 (25%) Frame = -1 Query: 461 FSGQTE--DHPDLLKYSCKVECKVRPVSPAKVWSPKT------------AEPREC 339 F G+TE + DLL S + C SP+ + SP T AEP+EC Sbjct: 1132 FHGETEIQNQTDLLSLSGRTLCVTAGASPSPISSPSTLLCQYLNLQLLNAEPQEC 1186 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,167,316 Number of Sequences: 219361 Number of extensions: 1371116 Number of successful extensions: 3962 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3961 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)