| Clone Name | rbaet117d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OAS2_HUMAN (P29728) 2'-5'-oligoadenylate synthetase 2 (EC 2.7.7.... | 28 | 6.9 | 2 | ARS2_CAEEL (Q966L5) Arsenite-resistance protein 2 homolog | 28 | 6.9 | 3 | UL88_HHV7J (P52364) Protein U59 | 27 | 9.0 |
|---|
>OAS2_HUMAN (P29728) 2'-5'-oligoadenylate synthetase 2 (EC 2.7.7.-)| ((2-5')oligo(A) synthetase 2) (2-5A synthetase 2) (p69 OAS / p71 OAS) (p69OAS / p71OAS) Length = 726 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 Query: 79 HNSIWNYCPWKNDTNKVMGQIHVQI 5 HNS+ +Y KN+ +K++ +IH Q+ Sbjct: 414 HNSLKSYTSQKNERHKIVKEIHEQL 438
>ARS2_CAEEL (Q966L5) Arsenite-resistance protein 2 homolog| Length = 712 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 345 QRPHNEHAGDGAGERGG 295 Q P ++H G G GERGG Sbjct: 629 QAPRDDHRGGGGGERGG 645
>UL88_HHV7J (P52364) Protein U59| Length = 347 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -3 Query: 215 CYLQSEVFSMQTVRPEVVHYNSTMHIKVQA 126 C L + ++S +T+ PE+V ++H+ V+A Sbjct: 257 CTLLNSIYSYKTLLPEIVDNTRSIHVVVKA 286 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,758,871 Number of Sequences: 219361 Number of extensions: 401512 Number of successful extensions: 871 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)