| Clone Name | rbaet117d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exog... | 30 | 3.4 | 2 | COP1_PEA (P93471) Ubiquitin ligase protein COP1 (EC 6.3.2.-) (Co... | 28 | 7.6 | 3 | RPM1_CAEEL (Q17551) Ubiquitin ligase protein rpm-1 (EC 6.3.2.-) ... | 28 | 9.9 | 4 | GUX1_NEUCR (P38676) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoc... | 28 | 9.9 |
|---|
>GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (1,4-beta-cellobiohydrolase) (Beta-glucancellobiohydrolase) Length = 525 Score = 29.6 bits (65), Expect = 3.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 327 TIDVMLTYDSRRRRRSTPSGATMCYFQNKW 238 T+ +T DS R SG+T CY NKW Sbjct: 45 TVQASITLDSNWRWTHQVSGSTNCYTGNKW 74
>COP1_PEA (P93471) Ubiquitin ligase protein COP1 (EC 6.3.2.-) (Constitutive| photomorphogenesis protein 1) Length = 672 Score = 28.5 bits (62), Expect = 7.6 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 6/62 (9%) Frame = +1 Query: 49 HVYIHERTTES---CAQMNAY---QHANDNYKVVIIIMGAWNKRN*KGMMEYKECKKDAS 210 H + E TT S C N Y Q A+ +Y+ ++ + W K +MEY+E +K A Sbjct: 408 HCPVVEMTTRSKLSCLSWNKYAKNQIASSDYEGIVTV---WTMTTRKSLMEYEEHEKRAW 464 Query: 211 SL 216 S+ Sbjct: 465 SV 466
>RPM1_CAEEL (Q17551) Ubiquitin ligase protein rpm-1 (EC 6.3.2.-)| (Pam/highwire/rpm-1 protein) (Regulator of presynaptic morphology protein 1) (Synapse defective protein 3) Length = 3766 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 222 LAGYYATYSGNSTSWLRTGSISSSFGCHM*ASH 320 L+G+ +T +G WL TGS+ + C + SH Sbjct: 1963 LSGHTSTSAGFLAKWLPTGSVVDASKCQLSLSH 1995
>GUX1_NEUCR (P38676) Exoglucanase 1 precursor (EC 3.2.1.91)| (Exocellobiohydrolase 1) (1,4-beta-cellobiohydrolase) Length = 516 Score = 28.1 bits (61), Expect = 9.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 327 TIDVMLTYDSRRRRRSTPSGATMCYFQNKWHS 232 T++ + D+ R SG+T CY NKW + Sbjct: 43 TLNTTMVLDANWRWTHATSGSTKCYTGNKWQA 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,197,786 Number of Sequences: 219361 Number of extensions: 908160 Number of successful extensions: 1863 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1863 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)