| Clone Name | rbaet117c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYO8_VIOOD (P58440) Cycloviolacin-O8 | 30 | 1.2 | 2 | SUHW1_HUMAN (P59817) Suppressor of hairy wing homolog 1 (3'OY11.1) | 28 | 5.8 | 3 | CHFR_MOUSE (Q810L3) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (... | 28 | 7.5 | 4 | CHFR_HUMAN (Q96EP1) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (... | 28 | 7.5 | 5 | GLMS_AGRT5 (Q8UEH1) Glucosamine--fructose-6-phosphate aminotrans... | 28 | 7.5 |
|---|
>CYO8_VIOOD (P58440) Cycloviolacin-O8| Length = 30 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 172 TAPCESCVHVSCARIKMVWTCRSSLC 95 T PCESCV + C + +C+S +C Sbjct: 2 TLPCESCVWIPCISSVVGCSCKSKVC 27
>SUHW1_HUMAN (P59817) Suppressor of hairy wing homolog 1 (3'OY11.1)| Length = 542 Score = 28.1 bits (61), Expect = 5.8 Identities = 19/67 (28%), Positives = 30/67 (44%) Frame = +2 Query: 2 LRCGHILSKVQKLHEIDQHPSIEIDKGVTNYAEAGSTRPHHFYSCTRYMNTRFARSCSTD 181 L C +L ++ ++ + H +E +K + E +T H C R T F C D Sbjct: 301 LSCVKVLKNIKFMNHMKHH--LEFEKQRNDSWEDHTTCQH----CHRQFPTPFQLQCHID 354 Query: 182 VVPVAMG 202 V +AMG Sbjct: 355 SVHIAMG 361
>CHFR_MOUSE (Q810L3) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (Checkpoint| with forkhead and RING finger domains protein) Length = 664 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 160 ESCVHVSCARIKMVWTCRSSLCVIC 86 + C+H CA W RSSLC C Sbjct: 317 QPCMHTFCAACYSGWMERSSLCPTC 341
>CHFR_HUMAN (Q96EP1) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (Checkpoint| with forkhead and RING finger domains protein) Length = 664 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 160 ESCVHVSCARIKMVWTCRSSLCVIC 86 + C+H CA W RSSLC C Sbjct: 318 QPCMHTFCAACYSGWMERSSLCPTC 342
>GLMS_AGRT5 (Q8UEH1) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 607 Score = 27.7 bits (60), Expect = 7.5 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 13 TYIVEG--TEITRDRSTSIDRN*QRSNKLRRGWIYTSTPFLFLHTIHEHTIRTELFDGRR 186 TY+V+G +TRD + ID + + + R+ I +T F+ H H + E+++ Sbjct: 203 TYLVDGDCAIVTRDGAEIIDFSGKPVKRERQ--ISQATAFVVDKGNHRHFMEKEIYEQPE 260 Query: 187 TSSHGRSSFV 216 SH S +V Sbjct: 261 VISHALSHYV 270 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,278,491 Number of Sequences: 219361 Number of extensions: 578270 Number of successful extensions: 1586 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1586 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)