| Clone Name | rbaet117b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O11H1_HUMAN (Q8NG94) Olfactory receptor 11H1 (Olfactory receptor... | 32 | 1.1 | 2 | POLB_CHPVU (Q9YTU2) ORFB polyprotein [Contains: Papain-like prot... | 29 | 5.2 | 3 | VFUS_VACC6 (P26312) 14 kDa fusion protein | 28 | 8.9 |
|---|
>O11H1_HUMAN (Q8NG94) Olfactory receptor 11H1 (Olfactory receptor 22-1) (OR22-1)| Length = 315 Score = 31.6 bits (70), Expect = 1.1 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 7/47 (14%) Frame = +2 Query: 299 YQVPASFLQQLPFHQLC-PN------CWPGPEITLDCWGIPSIMLSC 418 + +P + Q+PF C PN C PGP LDC P I L C Sbjct: 160 FLIPIVLISQMPF---CGPNIIDHVVCDPGPRFALDCVSAPRIQLFC 203
>POLB_CHPVU (Q9YTU2) ORFB polyprotein [Contains: Papain-like protease p48 (EC| 3.4.22.-); Putative RNA-directed RNA polymerase/Helicase (EC 2.7.7.48) (EC 3.6.1.-)] Length = 3164 Score = 29.3 bits (64), Expect = 5.2 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 2/76 (2%) Frame = +2 Query: 5 TKKKSAFHYVSKMDLQPCAMLLLEHK--RKGRIDSVIT*GRYTIQHASRSGHVQYTMLML 178 TKK + Y+SK+ +P A +++ R+GRI+++ + GR+T + Q ++ Sbjct: 2180 TKKITEVEYLSKLPRRPTAEDSADYRTWRQGRIENMRSSGRFTEEQMLSIEREQLPQFLM 2239 Query: 179 IPKCTKGVRHRLHFMH 226 + T + R F + Sbjct: 2240 VQNPTAILMRRTAFRY 2255
>VFUS_VACC6 (P26312) 14 kDa fusion protein| Length = 136 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = -2 Query: 457 SSTGASSHS*AERAAKHDRGNAPAIQSYLWSWPTIWA 347 SSTG+++ S + + A++ R +AP +QS WP +W+ Sbjct: 29 SSTGSANPSASRKPARYPRIHAPELQSGEARWP-LWS 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,427,882 Number of Sequences: 219361 Number of extensions: 1412569 Number of successful extensions: 3500 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3500 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)