| Clone Name | rbaet116b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FOLKE_LACLA (Q9CGE3) Bifunctional protein folKE [Includes: 2-ami... | 28 | 4.9 | 2 | MURE_WOLSU (Q7M8F9) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-... | 28 | 8.3 |
|---|
>FOLKE_LACLA (Q9CGE3) Bifunctional protein folKE [Includes:| 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3) (7,8 dihydro-6-hydroxymethylpterin-pyrophosphokinase) (HPPK) (6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase) Length = 349 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 44 MGSDQHYNQQRIFAIPSHPSLVIQNQSTFVTRTPV 148 +G Q+Y + I + HP ++I+ S F TPV Sbjct: 12 IGDRQYYLHEAIRLLGKHPKIMIEKVSNFYESTPV 46
>MURE_WOLSU (Q7M8F9) UDP-N-acetylmuramoylalanyl-D-glutamate--2,| 6-diaminopimelate ligase (EC 6.3.2.13) (UDP-N-acetylmuramyl-tripeptide synthetase) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-tripeptide synthetase) Length = 434 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 12 FTNHQVPAALLWDRTSIIIN-KGSLRYPLIHHSSYKTKARSLHG 140 F + P + D + N + +L Y + H SSY KA SLHG Sbjct: 181 FFDDSTPKLINKDESKAKFNLQNALSYGIEHPSSYHVKAYSLHG 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,887,028 Number of Sequences: 219361 Number of extensions: 677780 Number of successful extensions: 1305 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1305 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)