| Clone Name | rbaet115h03 |
|---|---|
| Clone Library Name | barley_pub |
>APX8_ORYSA (Q69SV0) Probable L-ascorbate peroxidase 8, chloroplast precursor| (EC 1.11.1.11) Length = 478 Score = 84.7 bits (208), Expect = 5e-17 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -1 Query: 331 SDXMKQKIRAEYEGLGGSPDKPMQSNYFLNIMIVIAGLAFLTSLVGN 191 SD MKQKIRAEYEG GGSPDKP+QSNYFLNIM++I GLAFLTSL+G+ Sbjct: 432 SDSMKQKIRAEYEGFGGSPDKPLQSNYFLNIMLLIGGLAFLTSLLGS 478
>PARN_BRARE (Q7ZU92) Poly(A)-specific ribonuclease PARN (EC 3.1.13.4)| (Polyadenylate-specific ribonuclease) Length = 660 Score = 28.9 bits (63), Expect = 3.4 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +2 Query: 146 LHQMKKKRLIRPPILVADQRRQECQSCDHDHNVE--EVVGLHRLIRAASKA--LVLGSDL 313 L KK+R I+ + ++RR+ Q E + VG R+IRA SK+ LV+G ++ Sbjct: 228 LETEKKERFIQISKVDDEERRRREQQKQQREQEELNDAVGFSRVIRAISKSGKLVVGHNM 287 Query: 314 LL 319 LL Sbjct: 288 LL 289
>TRMU_RICTY (Q68X66) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 358 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 22 SNLLGLPHFTSNDENSRQGKMTKSIALVILHVDTPVP 132 +N LG+PH+ + EN + + + LH +TP+P Sbjct: 61 ANKLGIPHYVLDYENKFKESVIDNFVNSYLHGETPLP 97
>SOX5_MOUSE (P35710) Transcription factor SOX-5| Length = 763 Score = 28.5 bits (62), Expect = 4.4 Identities = 28/104 (26%), Positives = 40/104 (38%), Gaps = 11/104 (10%) Frame = +1 Query: 28 LLGLPHFTSNDENSRQGKMTKSIALVILHVDTPVPGKWLITPDEKEETHQTTDLSCRPET 207 LLGLP QG + +++ +H D P K+E Q +LS +P+T Sbjct: 357 LLGLP----------QGNLGAAVSPTSIHTDKSTNSP---PPKSKDEVAQPLNLSAKPKT 403 Query: 208 S-----------RMPILRSRS*C*GSSWTA*AYPGCLQGPRTRL 306 S MP LR S G+ + P L P R+ Sbjct: 404 SDGKSPASPTSPHMPALRINS---GAGPLKASVPAALASPSARV 444
>TRMU_RICPR (Q9ZDM1) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 358 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 22 SNLLGLPHFTSNDENSRQGKMTKSIALVILHVDTPVP 132 +N LG+PH+ + EN + + + LH +TP+P Sbjct: 61 ANKLGIPHYVLDYENKFKESVIDNFVDSYLHGETPLP 97
>ZN493_HUMAN (Q6ZR52) Zinc finger protein 493| Length = 646 Score = 28.1 bits (61), Expect = 5.7 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 15/98 (15%) Frame = +2 Query: 41 LTLLQMMKTQDKV----R*PKALPWSSCMSTHQSLENG*LHQMKKKR-----------LI 175 LT+ +M+ T +K KA SS ++TH+ + G H+ K + L Sbjct: 404 LTIHKMIHTGEKPYKCEECGKAFNRSSHLTTHKRIHTG--HKPYKCKECGKSFSVFSTLT 461 Query: 176 RPPILVADQRRQECQSCDHDHNVEEVVGLHRLIRAASK 289 + I+ D++ +C+ C N ++ +H+ I K Sbjct: 462 KHKIIHTDKKPYKCEECGKAFNRSSILSIHKKIHTGEK 499
>OX2G_MOUSE (O54901) OX-2 membrane glycoprotein precursor (MRC OX-2 antigen)| (CD200 antigen) Length = 278 Score = 27.7 bits (60), Expect = 7.5 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 142 LITPDEKEETHQTTDLSCRPETSRMPIL 225 ++T DE++ H T L C +TS+ P++ Sbjct: 34 VVTQDERKALHTTASLRCSLKTSQEPLI 61
>PVG1_SCHPO (Q9UT27) Pyruvyltransferase 1 precursor (EC 2.-.-.-) (Pyruvylated| Gal-beta-1,3-epitope synthesis protein 1) (PvGal synthesis protein 1) Length = 401 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 1 RKHPMVSSNLLGLPHFTSNDENSRQGKMT 87 R H + S L+G+PH ENS+ GK+T Sbjct: 337 RLHAHILSTLMGIPHIVV--ENSQMGKIT 363
>UCRI1_TOBAC (P49729) Ubiquinol-cytochrome c reductase iron-sulfur subunit 1,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 1) (RISP1) (Fragment) Length = 258 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 19 SSNLLGLPHFTSNDENSRQGKMTKSIALVILH 114 SS + HF+S+D++S ++ S+A V LH Sbjct: 10 SSAFISANHFSSDDDSSSPRSISPSLASVFLH 41
>ATF2_MOUSE (P16951) Cyclic AMP-dependent transcription factor ATF-2| (Activating transcription factor 2) (cAMP response element-binding protein CRE-BP1) (MXBP protein) Length = 487 Score = 27.3 bits (59), Expect = 9.8 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 73 QGKMTKSIALVILHVDTPVPGKWLITPDEKE----ETHQTTDLSCRPETSRMP 219 + K+ + + H D+P+P T DEKE +T Q T RP + ++P Sbjct: 102 RSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVP 154
>ATF2_HUMAN (P15336) Cyclic AMP-dependent transcription factor ATF-2| (Activating transcription factor 2) (cAMP response element-binding protein CRE-BP1) (HB16) Length = 487 Score = 27.3 bits (59), Expect = 9.8 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +1 Query: 73 QGKMTKSIALVILHVDTPVPGKWLITPDEKE----ETHQTTDLSCRPETSRMP 219 + K+ + + H D+P+P T DEKE +T Q T RP + ++P Sbjct: 102 RSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVP 154
>SLAF9_MOUSE (Q9D780) SLAM family member 9 precursor| Length = 285 Score = 27.3 bits (59), Expect = 9.8 Identities = 16/54 (29%), Positives = 22/54 (40%) Frame = +1 Query: 31 LGLPHFTSNDENSRQGKMTKSIALVILHVDTPVPGKWLITPDEKEETHQTTDLS 192 L PH T N S +G S+ I V WL + D +H+ + LS Sbjct: 131 LSKPHITVNSNISEEGVCNISLTCSIERAGMDVTYIWLSSQDSTNTSHEGSVLS 184
>UCRI2_TOBAC (P51132) Ubiquinol-cytochrome c reductase iron-sulfur subunit 2,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 2) (RISP2) Length = 272 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 19 SSNLLGLPHFTSNDENSRQGKMTKSIALVILH 114 SS + HF+S+D++S ++ S+A V LH Sbjct: 24 SSAFISANHFSSDDDSSSPRSISPSLASVFLH 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,773,349 Number of Sequences: 219361 Number of extensions: 865414 Number of successful extensions: 1986 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1986 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)