| Clone Name | rbaet115e08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AROB_CAUCR (Q9A434) 3-dehydroquinate synthase (EC 4.2.3.4) | 29 | 5.0 | 2 | NCOR1_MOUSE (Q60974) Nuclear receptor corepressor 1 (N-CoR1) (N-... | 29 | 5.0 | 3 | PRP46_YEAST (Q12417) Pre-mRNA-splicing factor PRP46 (Pre-mRNA-pr... | 28 | 8.6 |
|---|
>AROB_CAUCR (Q9A434) 3-dehydroquinate synthase (EC 4.2.3.4)| Length = 370 Score = 29.3 bits (64), Expect = 5.0 Identities = 21/48 (43%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -3 Query: 454 AVVALCPDGDAQGELLKSACQEAGFVVEQIEVAPSALTK--EELASLS 317 AVV G GE L +A Q AG V+ I +AP +K E LA LS Sbjct: 41 AVVTDAHVGAHHGERLSAALQGAGITVDLITIAPGEESKSFEGLADLS 88
>NCOR1_MOUSE (Q60974) Nuclear receptor corepressor 1 (N-CoR1) (N-CoR) (Retinoid| X receptor-interacting protein 13) (RIP13) Length = 2453 Score = 29.3 bits (64), Expect = 5.0 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +3 Query: 327 ASSSFVSADGATSICSTTKPASWHADFRSSPCASPSGQRATTAP 458 A SS S++ A S +T A A +PCASPS TT P Sbjct: 746 AKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKP 789
>PRP46_YEAST (Q12417) Pre-mRNA-splicing factor PRP46 (Pre-mRNA-processing| protein 46) (Complexed with CEF1 protein 1) (PRP19-associated complex protein 50) (PRP nineteen-associated complex protein 50) Length = 451 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +1 Query: 145 DPVMT*TNKRK*TPVILLCSHLLPPSQISCFRLDSKTINSGRRAYI*IHEILLAK 309 D V+ + R PVI L H P +Q+ C +D + ++S A + + +++ K Sbjct: 245 DSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGK 299 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,529,710 Number of Sequences: 219361 Number of extensions: 805445 Number of successful extensions: 1928 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1928 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)