| Clone Name | rbaet115c01 |
|---|---|
| Clone Library Name | barley_pub |
>SMYD4_PONPY (Q5R5X9) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 0.82 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 296 YCHRCIKLLAGVLSCSGCS 352 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_HUMAN (Q8IYR2) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 0.82 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 296 YCHRCIKLLAGVLSCSGCS 352 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_CHICK (Q5F3V0) SET and MYND domain-containing protein 4| Length = 742 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 296 YCHRCIKLLAGVLSCSGCS 352 YCH C+K L + C GCS Sbjct: 294 YCHHCLKQLLASIPCCGCS 312
>UBR1_CAEEL (P91133) Ubiquitin-protein ligase E3 component N-recognin (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha) Length = 1927 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -1 Query: 354 PEQPEQLSTPANNLMQRWQYCSSCPSGAS*PHKRTGFVLAVLLLHRAHP 208 P +P+ TP + L+ S P+ A PH T F V L + A P Sbjct: 1560 PPRPKLAQTPGSPLLSAPSTSSFTPAPAQIPHSGTNFAFLVQLFNPAGP 1608
>CATA_BACST (P14412) Peroxidase/catalase (EC 1.11.1.6) (Catalase-peroxidase)| Length = 735 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 156 WWPLSLSLTCMHRH*TRPDGHD 221 WWP L+L+ +H+H + + HD Sbjct: 31 WWPNQLNLSILHQHDRKTNPHD 52
>TELT_MOUSE (O70548) Telethonin (Titin cap protein)| Length = 167 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 191 QTLNEAGWARWRSSTANTKPVRLCG*LAPDGHEEQYCHR 307 Q EA WA W+ T +T+P C D + HR Sbjct: 15 QERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHR 53
>MDC1_RAT (Q5U2M8) Mediator of DNA damage checkpoint protein 1| Length = 1279 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -1 Query: 378 GHQGARLLPEQPEQLSTPANNLMQRWQYCSSCPSGAS*PHKR 253 G QG+R P P+ STPA Q SS S A PH++ Sbjct: 979 GKQGSRTAPVGPKSYSTPAEPEPQSSASQSSGASEADSPHQK 1020
>SMYD4_MOUSE (Q8BTK5) SET and MYND domain-containing protein 4| Length = 799 Score = 28.5 bits (62), Expect = 4.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 296 YCHRCIKLLAGVLSCSGCS 352 YCHRC+K + C CS Sbjct: 295 YCHRCLKHTLATVPCGSCS 313
>BAI2_HUMAN (O60241) Brain-specific angiogenesis inhibitor 2 precursor| Length = 1572 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 390 PPGGGHQGARLLPEQPEQLS 331 PPG GH RLLP P++ S Sbjct: 781 PPGPGHSHQRLLPADPDESS 800
>GAG_HV1A2 (P03349) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 501 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -1 Query: 384 GGGHQGARLLPEQPEQLSTPANNLMQRWQY 295 G GH+ AR+L E Q++ PAN +MQR + Sbjct: 356 GPGHK-ARVLAEAMSQVTNPANIMMQRGNF 384
>POL_HV1A2 (P03369) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1436 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -1 Query: 384 GGGHQGARLLPEQPEQLSTPANNLMQRWQY 295 G GH+ AR+L E Q++ PAN +MQR + Sbjct: 356 GPGHK-ARVLAEAMSQVTNPANIMMQRGNF 384
>DSRAD_HUMAN (P55265) Double-stranded RNA-specific adenosine deaminase (EC| 3.5.4.-) (DRADA) (136 kDa double-stranded RNA-binding protein) (P136) (K88DSRBP) (Interferon-inducible protein 4) (IFI-4 protein) Length = 1226 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 135 KSENGDPWWPLSLSLTCMHRH*--TRPDGHDGGAVLPTRSPSV 257 K P W +++S ++H RPDGH GA P PS+ Sbjct: 187 KEAGTPPLWKIAVSTQAWNQHSGVVRPDGHSQGA--PNSDPSL 227
>ZN297_MOUSE (Q9Z0G7) Zinc finger protein 297 (BING1 protein)| Length = 638 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -2 Query: 308 NGGSTAPRVHPALASHTNGRASCWQYCSSIVPIRPR 201 NGG+ AP ++ SHT+ RAS Q SS PR Sbjct: 178 NGGTVAPATVGSVRSHTSSRASENQSPSSSNYFSPR 213
>VIF_CAEVC (P33462) Virion infectivity factor (Q protein) (SOR protein)| Length = 229 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/50 (30%), Positives = 18/50 (36%) Frame = -1 Query: 306 RWQYCSSCPSGAS*PHKRTGFVLAVLLLHRAHPASFSVCACM*VREREAT 157 RW C SC G H RT + ++LL F V R T Sbjct: 150 RWDLCKSCAQGEVVKHTRTKSLERLVLLQMVEQHVFQVLPLWRARRSSTT 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,632,107 Number of Sequences: 219361 Number of extensions: 1072127 Number of successful extensions: 2635 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2634 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)