| Clone Name | rbaet113h06 |
|---|---|
| Clone Library Name | barley_pub |
>UBR1_CAEEL (P91133) Ubiquitin-protein ligase E3 component N-recognin (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha) Length = 1927 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 368 PEQPEQLSTPANNLMQRWQYCSSCPSGAS*PHKRTGFVLAVLLLHRAHP 222 P +P+ TP + L+ S P+ A PH T F V L + A P Sbjct: 1560 PPRPKLAQTPGSPLLSAPSTSSFTPAPAQIPHSGTNFAFLVQLFNPAGP 1608
>CATA_BACST (P14412) Peroxidase/catalase (EC 1.11.1.6) (Catalase-peroxidase)| Length = 735 Score = 28.9 bits (63), Expect = 3.2 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 170 WWPLSLSLTCMHRH*TRPDGHD 235 WWP L+L+ +H+H + + HD Sbjct: 31 WWPNQLNLSILHQHDRKTNPHD 52
>TELT_MOUSE (O70548) Telethonin (Titin cap protein)| Length = 167 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 205 QTLNEAGWARWRSSTANTKPVRLCG*LAPDGHEEQYCHR 321 Q EA WA W+ T +T+P C D + HR Sbjct: 15 QERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHR 53
>DSRAD_HUMAN (P55265) Double-stranded RNA-specific adenosine deaminase (EC| 3.5.4.-) (DRADA) (136 kDa double-stranded RNA-binding protein) (P136) (K88DSRBP) (Interferon-inducible protein 4) (IFI-4 protein) Length = 1226 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 149 KSENGDPWWPLSLSLTCMHRH*--TRPDGHDGGAVLPTRSPSV 271 K P W +++S ++H RPDGH GA P PS+ Sbjct: 187 KEAGTPPLWKIAVSTQAWNQHSGVVRPDGHSQGA--PNSDPSL 227
>VIF_CAEVC (P33462) Virion infectivity factor (Q protein) (SOR protein)| Length = 229 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/50 (30%), Positives = 18/50 (36%) Frame = -3 Query: 320 RWQYCSSCPSGAS*PHKRTGFVLAVLLLHRAHPASFSVCACM*VREREAT 171 RW C SC G H RT + ++LL F V R T Sbjct: 150 RWDLCKSCAQGEVVKHTRTKSLERLVLLQMVEQHVFQVLPLWRARRSSTT 199
>ZN297_MOUSE (Q9Z0G7) Zinc finger protein 297 (BING1 protein)| Length = 638 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -1 Query: 322 NGGSTAPRVHPALASHTNGRASCWQYCSSIVPIRPR 215 NGG+ AP ++ SHT+ RAS Q SS PR Sbjct: 178 NGGTVAPATVGSVRSHTSSRASENQSPSSSNYFSPR 213 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,830,615 Number of Sequences: 219361 Number of extensions: 914868 Number of successful extensions: 2078 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2077 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)