| Clone Name | rbaet113e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CY561_PIG (Q95245) Cytochrome b561 (Cytochrome b-561) | 29 | 3.2 | 2 | RCNA_ECOL6 (Q8FFX9) Nickel/cobalt efflux system rcnA | 29 | 3.2 | 3 | IBMP_CAMVW (Q05651) Inclusion body matrix protein (Viroplasmin) | 27 | 9.3 | 4 | CY561_MOUSE (Q60720) Cytochrome b561 (Cytochrome b-561) | 27 | 9.3 |
|---|
>CY561_PIG (Q95245) Cytochrome b561 (Cytochrome b-561)| Length = 252 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 212 SPHARLVWPFIIPYHV-FQYLQNEFGITVMTVTGQWVSVF 96 SP R P +PY+V F L G+TV+ VTG W+ + Sbjct: 3 SPAGRTPAPGALPYYVAFSQL---LGLTVVAVTGAWLGAY 39
>RCNA_ECOL6 (Q8FFX9) Nickel/cobalt efflux system rcnA| Length = 274 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +1 Query: 118 VTVITVIPNSFCKYWKTW*GMIKGQTNRACGDHK*QRHSA*NHGD 252 ++ + +I +F +W+TW G N DH+ H +H D Sbjct: 93 ISAVIIISTAFWMFWRTWRGERNWLENMHEHDHEHHHHDHEDHHD 137
>IBMP_CAMVW (Q05651) Inclusion body matrix protein (Viroplasmin)| Length = 520 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 53 LLHKMTQILQTWVKKKLTPTD 115 LLHK Q+++ V KKL PT+ Sbjct: 355 LLHKPRQVIEIGVSKKLVPTE 375
>CY561_MOUSE (Q60720) Cytochrome b561 (Cytochrome b-561)| Length = 250 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 206 HARLVWPFIIPYHV-FQYLQNEFGITVMTVTGQWVSVF 96 H+ P +PY+V F L G+TV+ VTG W+ ++ Sbjct: 3 HSSASVPAALPYYVAFSQL---LGLTVVAVTGAWLGLY 37 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,174,935 Number of Sequences: 219361 Number of extensions: 832667 Number of successful extensions: 2460 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2460 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)