| Clone Name | rbaet113e01 |
|---|---|
| Clone Library Name | barley_pub |
>STAT1_PIG (Q764M5) Signal transducer and activator of transcription 1| Length = 757 Score = 31.6 bits (70), Expect = 1.2 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +3 Query: 69 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 176 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>STAT1_HUMAN (P42224) Signal transducer and activator of transcription| 1-alpha/beta (Transcription factor ISGF-3 components p91/p84) Length = 750 Score = 31.6 bits (70), Expect = 1.2 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +3 Query: 69 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 176 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>APE1_AERPE (O73942) Homing endonuclease I-ApeI (EC 3.1.-.-) (rRNA| intron-encoded homing endonuclease 1) Length = 222 Score = 30.4 bits (67), Expect = 2.6 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -3 Query: 458 KLKGIDGRAPPGVEPAA 408 KLKGI G AP GVEPAA Sbjct: 206 KLKGIGGGAPQGVEPAA 222
>MPD2_YEAST (Q99316) Protein disulfide isomerase MPD2 precursor (EC 5.3.4.1)| Length = 277 Score = 28.9 bits (63), Expect = 7.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 365 LCLDLVSFPVLGQIKPQAPRLVVP 436 LC DL FP++ +KP+ LV+P Sbjct: 98 LCTDLPGFPIIELVKPRTKPLVLP 121
>DPOLZ_MOUSE (Q61493) DNA polymerase zeta catalytic subunit (EC 2.7.7.7)| (Seizure-related protein 4) Length = 3122 Score = 28.5 bits (62), Expect = 9.7 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +2 Query: 281 QTNRSTN*ERPCTTTHRIKKELSVCQSLLCLDLVSFPVLGQIKPQAPRLVVPFRQ 445 Q +STN + T+TH+ K +SV + + PV KP+ PR P Q Sbjct: 1537 QKAQSTNVVQDSTSTHQPDKNISVSNEHKKANKRTRPVTSPRKPRTPRRTKPKEQ 1591
>PE2R4_HUMAN (P35408) Prostaglandin E2 receptor, EP4 subtype (Prostanoid EP4| receptor) (PGE receptor, EP4 subtype) Length = 488 Score = 28.5 bits (62), Expect = 9.7 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -2 Query: 255 SAC*LAMRSHPSAASFLEGLSPFRRRK-FEAITG 157 +A +A R HP+A+ L LS FRRR+ F I G Sbjct: 232 AAASVASRGHPAASPALPRLSDFRRRRSFRRIAG 265 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,764,073 Number of Sequences: 219361 Number of extensions: 1467187 Number of successful extensions: 2991 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2991 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)