| Clone Name | rbaet112e11 |
|---|---|
| Clone Library Name | barley_pub |
>PCDA9_PANTR (Q5DRE3) Protocadherin alpha 9 precursor (PCDH-alpha9)| Length = 950 Score = 30.4 bits (67), Expect = 2.0 Identities = 15/40 (37%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 54 PQLTRVYIHIYMYMQLCTV---LVYTSI*YTIIQCLSAAP 164 P++T V +++Y+ + +C V LV T + YT+++C SA P Sbjct: 689 PEVTLVDVNVYLIIAICAVSSLLVLTLLLYTVLRC-SAMP 727
>PCDA9_HUMAN (Q9Y5H5) Protocadherin alpha 9 precursor (PCDH-alpha9)| Length = 950 Score = 30.4 bits (67), Expect = 2.0 Identities = 15/40 (37%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 54 PQLTRVYIHIYMYMQLCTV---LVYTSI*YTIIQCLSAAP 164 P++T V +++Y+ + +C V LV T + YT+++C SA P Sbjct: 689 PEVTLVDVNVYLIIAICAVSSLLVLTLLLYTVLRC-SAMP 727
>SEPT3_MOUSE (Q9Z1S5) Neuronal-specific septin-3| Length = 465 Score = 29.6 bits (65), Expect = 3.4 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Frame = -1 Query: 271 SYVWMPEGAPHQGKFVYGICYVACV---IYVCMAG*LRCGAADKHCIIVYQILVYTSTVH 101 S+ +P+ + + +C CV +YVCM + C VY ++ ++ V Sbjct: 354 SFQSVPQACWYLCSILSSVCVCVCVCVCMYVCMC------VMESAC--VYVCVMESACVC 405 Query: 100 NCIYIYICMYTRV 62 C+ +Y+C+Y+ V Sbjct: 406 VCMCVYVCVYSGV 418
>EFTS_SYMTH (Q67PB6) Elongation factor Ts (EF-Ts)| Length = 304 Score = 29.3 bits (64), Expect = 4.4 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = +2 Query: 89 VYAIMHGTSIY*YLIHNYTMFVRSSTPKLASHAYIDYTCHITYSVYELTLMRCTLRHPYI 268 V+A +HG LI + ++TP++A+H ++ CH EL L ++R Y+ Sbjct: 148 VHAYIHGDGRVGVLIE-----LTTATPEVAAHPEVEALCH------ELALQIASMRAQYV 196 Query: 269 R 271 R Sbjct: 197 R 197
>RPOA_EAVBU (P19811) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1 papain-like cysteine proteinase (EC 3.4.22.-) (PCP); Nsp2 cysteine proteinase (EC 3.4.22.-) (CP2) (CP); Nonstructural protein Length = 3175 Score = 28.5 bits (62), Expect = 7.6 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = -1 Query: 235 GKFVYGICYVACVI---YVCMAG*LRCGAADKHCIIVYQILVYTSTVHNC 95 G ++YGICY V+ + C+ G D C V+ + V T T +C Sbjct: 831 GGWIYGICYFVLVVVSTFTCLPIKCGIGTRDPFCRRVFSVPV-TKTQEHC 879
>ARN_BPT4 (P39510) Anti-restriction endonuclease (Anti-rgl nuclease)| Length = 92 Score = 28.5 bits (62), Expect = 7.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 136 QLYNVCPQLHTEVSQPCIHRLHMPHNIFRIRTYLD 240 +LY P L+ + + LH+ +N F I TY D Sbjct: 20 KLYKFLPNLYHSIVNELVEELHLENNDFLIGTYKD 54
>KCMB2_RAT (Q811Q0) Calcium-activated potassium channel beta subunit 2| (Calcium-activated potassium channel, subfamily M, beta subunit 2) (Maxi K channel beta subunit 2) (BK channel beta subunit 2) (Slo-beta 2) (K(VCA)beta 2) (Charybdotoxin receptor beta Length = 235 Score = 28.1 bits (61), Expect = 9.9 Identities = 17/57 (29%), Positives = 31/57 (54%) Frame = -2 Query: 372 QARAVLLSVPFIIRSIHCNHHLHPHACGSDVYLLRMYGCLRVHRIKVSSYTEYVMWH 202 +A+ LL+V I + +C+ +CG D + L Y CL+V+ SS + +++H Sbjct: 81 EAQRALLNVS-ITETFNCSF-----SCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYH 131
>KCMB2_MOUSE (Q9CZM9) Calcium-activated potassium channel beta subunit 2| (Calcium-activated potassium channel, subfamily M, beta subunit 2) (Maxi K channel beta subunit 2) (BK channel beta subunit 2) (Slo-beta 2) (K(VCA)beta 2) (Charybdotoxin receptor bet Length = 235 Score = 28.1 bits (61), Expect = 9.9 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = -2 Query: 372 QARAVLLSVPFIIRSIHCNHHLHPHACGSDVYLLRMYGCLRVHRIKVSSYTEYVMWH 202 +A+ LL+V I + +C+ +CG D + L Y CL+V+ SS +++H Sbjct: 81 EAQCALLNVS-ITETFNCSF-----SCGPDCWKLSQYPCLQVYVNLTSSGERLLLYH 131
>HUNB_SCICO (Q01790) Protein hunchback (Fragment)| Length = 50 Score = 28.1 bits (61), Expect = 9.9 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 28 LKRMLHTQHHNSHVYTYIYICI-CNYA 105 + R + T H SH TY Y C+ CNYA Sbjct: 21 VNRSMLTSHMKSHSNTYPYRCLDCNYA 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,621,944 Number of Sequences: 219361 Number of extensions: 1280746 Number of successful extensions: 3078 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3076 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)