| Clone Name | rbaet112d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GIDA_TREPA (O83084) tRNA uridine 5-carboxymethylaminomethyl modi... | 30 | 1.9 | 2 | NIFB_AZOVI (P11067) FeMo cofactor biosynthesis protein nifB | 29 | 4.1 | 3 | ZN294_MOUSE (Q6A009) Zinc finger protein 294 (Zfp-294) | 29 | 4.1 |
|---|
>GIDA_TREPA (O83084) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 630 Score = 30.4 bits (67), Expect = 1.9 Identities = 18/64 (28%), Positives = 31/64 (48%) Frame = +2 Query: 74 QSITLTAKATQHTPKFSFSVQHTIPCSY*TVLYSIYYREHALIYARTRKATACFVYVCTD 253 Q + T + TQH + +V + + Y Y HA++ AR R+ +A V + T Sbjct: 107 QKVKYTLECTQHLHLYQDTVVDVVCSNTTDAGYVAYGAAHAVVTARGRRISARAVVLTTG 166 Query: 254 TWMK 265 T+M+ Sbjct: 167 TFME 170
>NIFB_AZOVI (P11067) FeMo cofactor biosynthesis protein nifB| Length = 502 Score = 29.3 bits (64), Expect = 4.1 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = -1 Query: 275 SSEPSSMYLCIRTQNMPLPSAFEHISKHVLCSI*NTVQFNKNRVLCVEPK 126 S + M LC+ T + LP E ++KH + + T+ N CV+P+ Sbjct: 138 SEQAPDMKLCVSTNGLALPECVEELAKHNIDHV--TITIN-----CVDPE 180
>ZN294_MOUSE (Q6A009) Zinc finger protein 294 (Zfp-294)| Length = 1767 Score = 29.3 bits (64), Expect = 4.1 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +2 Query: 47 KTRFTEEITQSITLTAKATQHTPKFSFSVQH 139 KT FTEE+ SI TA H P + SV H Sbjct: 1540 KTFFTEEVQLSIRETATLPYHIPHLACSVYH 1570 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,518,694 Number of Sequences: 219361 Number of extensions: 890330 Number of successful extensions: 1868 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1868 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)